Molecule Information

General Information of the Molecule (ID: Mol00751)

Name	23S ribosomal RNA methyltransferase Erm (ERM39) ,Mycobacterium fortuitum
Synonyms	erm(39); 23S ribosomal RNA methyltransferase Erm Click to Show/Hide
Molecule Type	Protein
Gene Name	erm(39)
Sequence	MSSAHHGRHENGQNFLRDRRVVGDIIRMVSHTTGPIVEIGAGDGALTLPLQRLGRPLTAI EIDLHRARRLADRTTAEVVATDFLRYRLPRTPHVVVGNLPFHLTTAILRRLLHENGWTDA TLLVQWEVARRRAGVGGATMMTAQWWPWFEFGLARKVSADAFRPRPSVDAGLLTIQRRAE PLLPWADHRAYQALVHRVFTGRGRGLAQILRPHVHPRWLSTNGIHPSALPRALTAQQWVA LFEAAG Click to Show/Hide
Uniprot ID	A0A481WX14_MYCFO
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Actinobacteria Class: Actinomycetia Order: Corynebacteriales Family: Mycobacteriaceae Genus: Mycolicibacterium Species: Mycolicibacterium fortuitum

Type(s) of Resistant Mechanism of This Molecule

ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s)

5 drug(s) in total

Click to Show/Hide the Full List of Drugs

Clarithromycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Mycobacterium fortuitum infection			[1]
Resistant Disease	Mycobacterium fortuitum infection [ICD-11: 1B2Z.2]		Disease Info
Resistant Drug	Clarithromycin		Drug Info
Molecule Alteration	Missense mutation	Putative initiation codon GTG>CTG
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Mycobacterium peregrinum ATCC14467		43304
Experiment for Molecule Alteration	DNA sequencing assay
Experiment for Drug Resistance	Mueller-Hinton (MH) broth assay
Mechanism Description	The erm genes are a diverse collection of methylases that add one or two methyl groups to the adenine at position 2058 (Escherichia coli numbering) of the 23S rRNA; this modification impairs the binding of macrolides to ribosomes, and thus reduces the inhibitory activity of these agents.

Clindamycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Mycobacterium fortuitum infection			[1]
Resistant Disease	Mycobacterium fortuitum infection [ICD-11: 1B2Z.2]		Disease Info
Resistant Drug	Clindamycin		Drug Info
Molecule Alteration	Missense mutation	Putative initiation codon GTG>CTG
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Mycobacterium peregrinum ATCC14467		43304
Experiment for Molecule Alteration	DNA sequencing assay
Experiment for Drug Resistance	Mueller-Hinton (MH) broth assay
Mechanism Description	The erm genes are a diverse collection of methylases that add one or two methyl groups to the adenine at position 2058 (Escherichia coli numbering) of the 23S rRNA; this modification impairs the binding of macrolides to ribosomes, and thus reduces the inhibitory activity of these agents.

Erythromycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Mycobacterium fortuitum infection			[1]
Resistant Disease	Mycobacterium fortuitum infection [ICD-11: 1B2Z.2]		Disease Info
Resistant Drug	Erythromycin		Drug Info
Molecule Alteration	Missense mutation	Putative initiation codon GTG>CTG
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Mycobacterium peregrinum ATCC14467		43304
Experiment for Molecule Alteration	DNA sequencing assay
Experiment for Drug Resistance	Mueller-Hinton (MH) broth assay
Mechanism Description	The erm genes are a diverse collection of methylases that add one or two methyl groups to the adenine at position 2058 (Escherichia coli numbering) of the 23S rRNA; this modification impairs the binding of macrolides to ribosomes, and thus reduces the inhibitory activity of these agents.

Quinupristin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Mycobacterium fortuitum infection			[1]
Resistant Disease	Mycobacterium fortuitum infection [ICD-11: 1B2Z.2]		Disease Info
Resistant Drug	Quinupristin		Drug Info
Molecule Alteration	Missense mutation	Putative initiation codon GTG>CTG
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Mycobacterium peregrinum ATCC14467		43304
Experiment for Molecule Alteration	DNA sequencing assay
Experiment for Drug Resistance	Mueller-Hinton (MH) broth assay
Mechanism Description	The erm genes are a diverse collection of methylases that add one or two methyl groups to the adenine at position 2058 (Escherichia coli numbering) of the 23S rRNA; this modification impairs the binding of macrolides to ribosomes, and thus reduces the inhibitory activity of these agents.

Spiramycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Mycobacterium fortuitum infection			[1]
Resistant Disease	Mycobacterium fortuitum infection [ICD-11: 1B2Z.2]		Disease Info
Resistant Drug	Spiramycin		Drug Info
Molecule Alteration	Missense mutation	Putative initiation codon GTG>CTG
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Mycobacterium peregrinum ATCC14467		43304
Experiment for Molecule Alteration	DNA sequencing assay
Experiment for Drug Resistance	Mueller-Hinton (MH) broth assay
Mechanism Description	The erm genes are a diverse collection of methylases that add one or two methyl groups to the adenine at position 2058 (Escherichia coli numbering) of the 23S rRNA; this modification impairs the binding of macrolides to ribosomes, and thus reduces the inhibitory activity of these agents.

References

Ref 1	Molecular basis of intrinsic macrolide resistance in clinical isolates of Mycobacterium fortuitum. J Antimicrob Chemother. 2005 Feb;55(2):170-7. doi: 10.1093/jac/dkh523. Epub 2004 Dec 8.