Molecule Information

General Information of the Molecule (ID: Mol04388)

• Name: ADP-ribosylation factor 6 (ARF6) ,Homo sapiens
• Molecule Type: Protein
• Gene Name: ARF6
• Gene ID: 382
• Sequence:
  MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN
  VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILI
  F ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS
• Function: GTP-binding protein involved in protein trafficking thatregulates endocytic recycling and cytoskeleton remodeling. GTP-bound form plays an importantrole in the transport of multiple palmitoylated proteins form the Golgito the plasma membrane . Required for normalcompletion of mitotic cytokinesis . Plays a role in thereorganization of the actin cytoskeleton and the formation of stressfibers . Involved in the regulation of dendritic spinedevelopment, contributing to the regulation of dendritic branching andfilopodia extension . Potentiates the neuriteoutgrowth in primary neurons by interacting with the molecular adapterAPBB1 . Plays an important role in membranetrafficking, during junctional remodeling and epithelial polarization. Regulates surface levels of adherens junctionproteins such as CDH1 . Required for NTRK1 sorting tothe recycling pathway from early endosomes .{ECO:0000250|UniProtKB:P62331, ECO:0000250|UniProtKB:P62332,ECO:0000269|PubMed:11266366, ECO:0000269|PubMed:14978216,ECO:0000269|PubMed:16099990, ECO:0000269|PubMed:16737952,ECO:0000269|PubMed:18400762, ECO:0000269|PubMed:21170023,ECO:0000269|PubMed:32103017, ECO:0000269|PubMed:36017701,ECO:0000269|PubMed:36250347, ECO:0000269|PubMed:37461827,ECO:0000269|PubMed:7589240}.; Functions as an allosteric activator ofthe cholera toxin catalytic subunit, an ADP-ribosyltransferase.{ECO:0000269|PubMed:16099990}.; Plays a key role in the endocytosis ofenterovirus 71 and thus viral entry into brain microvascularendothelial cells. {ECO:0000269|PubMed:37417384}.
• Uniprot ID: ARF6_HUMAN
• Ensembl ID: ENSG000001655278
• HGNC ID: HGNC:659

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 2 drug(s) in total

Beta-elemene

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Gastric adenocarcinoma [ICD-11: 2B72.0] [1]

• Sensitive Disease: Gastric adenocarcinoma [ICD-11: 2B72.0]
• Sensitive Drug: Beta-elemene
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• In Vitro Model: AGS/DDP cells; Gastric; Homo sapiens (Human); N.A.
• In Vitro Model: HGC-27/DDP cells; Gastric; Homo sapiens (Human); N.A.
• Experiment for Molecule Alteration: Western blot assay; qRT-PCR
• Experiment for Drug Resistance: Flow cytometry assay; Transwell assay
• Mechanism Description: This research revealed that beta-elemene could relieve DDP resistance and inhibit tumor growth of GC via suppressing intracellular and exosome-METTL3 expression in and from DDP-resistance GC cells

Cisplatin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Gastric adenocarcinoma [ICD-11: 2B72.0] [1]

• Resistant Disease: Gastric adenocarcinoma [ICD-11: 2B72.0]
• Resistant Drug: Cisplatin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• In Vitro Model: AGS/DDP cells; Gastric; Homo sapiens (Human); N.A.
• In Vitro Model: HGC-27/DDP cells; Gastric; Homo sapiens (Human); N.A.
• Experiment for Molecule Alteration: Western blot assay; qRT-PCR
• Experiment for Drug Resistance: Flow cytometry assay; Transwell assay
• Mechanism Description: This research revealed that beta-elemene could relieve DDP resistance and inhibit tumor growth of GC via suppressing intracellular and exosome-METTL3 expression in and from DDP-resistance GC cells

References

• Ref 1: beta-elemene Ameliorates Cisplatin Resistance of Gastric Cancer via Regulating Exosomal METTL3-m6A-ARF6 Axis. Cell Biochem Biophys. 2025 Jun;83(2):2047-2058.