Molecule Information

General Information of the Molecule (ID: Mol04357)

• Name: CAMPATH-1 antigen (CD52) ,Homo sapiens
• Synonyms: CDw52; Cambridge pathology 1 antigen; Epididymal secretory protein E5; Human epididymis-specific protein 5; CD_antigen=CD52
• Molecule Type: Protein
• Gene Name: CD52
• Gene ID: 1043
• Sequence:
  MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCF
  S
• Function: May play a role in carrying and orienting carbohydrate, aswell as having a more specific role.
• Uniprot ID: CD52_HUMAN
• Ensembl ID: ENSG000001694429
• HGNC ID: HGNC:1804

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s) 7 drug(s) in total

Cyclophosphamide

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: t-cell prolymphocytic leukemia [ICD-11: 2A90.0] [1]

• Resistant Disease: t-cell prolymphocytic leukemia [ICD-11: 2A90.0]
• Resistant Drug: Cyclophosphamide
• Molecule Alteration: Expressiom; L747S
• Experimental Note: Identified from the Human Clinical Data
• In Vivo Model: T-cell prolymphocytic leukemia patient; Homo sapiens
• Experiment for Molecule Alteration: Flow cytometry
• Experiment for Drug Resistance: Overall survival assay
• Mechanism Description: MTX-HOPE is a combination of classical chemotherapy agents originally developed for palliative chemotherapy in frail patients with refractory lymphoma. MTX-HOPE has been reported to be effective against T-cell tumors. Severe nonhematologic adverse events are rarely reported; however, bone marrow suppression is commonly observed.

Etoposide

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: t-cell prolymphocytic leukemia [ICD-11: 2A90.0] [1]

• Sensitive Disease: t-cell prolymphocytic leukemia [ICD-11: 2A90.0]
• Sensitive Drug: Etoposide
• Molecule Alteration: Expressiom; Down-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vivo Model: T-cell prolymphocytic leukemia patient; Homo sapiens
• Experiment for Molecule Alteration: Flow cytometry
• Experiment for Drug Resistance: Overall survival assay
• Mechanism Description: MTX-HOPE is a combination of classical chemotherapy agents originally developed for palliative chemotherapy in frail patients with refractory lymphoma. MTX-HOPE has been reported to be effective against T-cell tumors. Severe nonhematologic adverse events are rarely reported; however, bone marrow suppression is commonly observed.

Hydrocortisone

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: t-cell prolymphocytic leukemia [ICD-11: 2A90.0] [1]

• Sensitive Disease: t-cell prolymphocytic leukemia [ICD-11: 2A90.0]
• Sensitive Drug: Hydrocortisone
• Molecule Alteration: Expressiom; Down-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vivo Model: T-cell prolymphocytic leukemia patient; Homo sapiens
• Experiment for Molecule Alteration: Flow cytometry
• Experiment for Drug Resistance: Overall survival assay
• Mechanism Description: MTX-HOPE is a combination of classical chemotherapy agents originally developed for palliative chemotherapy in frail patients with refractory lymphoma. MTX-HOPE has been reported to be effective against T-cell tumors. Severe nonhematologic adverse events are rarely reported; however, bone marrow suppression is commonly observed.

Methotrexate

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: t-cell prolymphocytic leukemia [ICD-11: 2A90.0] [1]

• Sensitive Disease: t-cell prolymphocytic leukemia [ICD-11: 2A90.0]
• Sensitive Drug: Methotrexate
• Molecule Alteration: Expressiom; Down-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vivo Model: T-cell prolymphocytic leukemia patient; Homo sapiens
• Experiment for Molecule Alteration: Flow cytometry
• Experiment for Drug Resistance: Overall survival assay
• Mechanism Description: MTX-HOPE is a combination of classical chemotherapy agents originally developed for palliative chemotherapy in frail patients with refractory lymphoma. MTX-HOPE has been reported to be effective against T-cell tumors. Severe nonhematologic adverse events are rarely reported; however, bone marrow suppression is commonly observed.

Tofacitinib

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: t-cell prolymphocytic leukemia [ICD-11: 2A90.0] [1]

• Resistant Disease: t-cell prolymphocytic leukemia [ICD-11: 2A90.0]
• Resistant Drug: Tofacitinib
• Molecule Alteration: Expressiom; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vivo Model: T-cell prolymphocytic leukemia patient; Homo sapiens
• Experiment for Molecule Alteration: Flow cytometry
• Experiment for Drug Resistance: Overall survival assay
• Mechanism Description: MTX-HOPE is a combination of classical chemotherapy agents originally developed for palliative chemotherapy in frail patients with refractory lymphoma. MTX-HOPE has been reported to be effective against T-cell tumors. Severe nonhematologic adverse events are rarely reported; however, bone marrow suppression is commonly observed.

Venetoclax

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: t-cell prolymphocytic leukemia [ICD-11: 2A90.0] [1]

• Resistant Disease: t-cell prolymphocytic leukemia [ICD-11: 2A90.0]
• Resistant Drug: Venetoclax
• Molecule Alteration: Expressiom; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vivo Model: T-cell prolymphocytic leukemia patient; Homo sapiens
• Experiment for Molecule Alteration: Flow cytometry
• Experiment for Drug Resistance: Overall survival assay
• Mechanism Description: MTX-HOPE is a combination of classical chemotherapy agents originally developed for palliative chemotherapy in frail patients with refractory lymphoma. MTX-HOPE has been reported to be effective against T-cell tumors. Severe nonhematologic adverse events are rarely reported; however, bone marrow suppression is commonly observed.

Vincristine

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: t-cell prolymphocytic leukemia [ICD-11: 2A90.0] [1]

• Resistant Disease: t-cell prolymphocytic leukemia [ICD-11: 2A90.0]
• Resistant Drug: Vincristine
• Molecule Alteration: Expressiom; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vivo Model: T-cell prolymphocytic leukemia patient; Homo sapiens
• Experiment for Molecule Alteration: Flow cytometry
• Experiment for Drug Resistance: Overall survival assay
• Mechanism Description: MTX-HOPE is a combination of classical chemotherapy agents originally developed for palliative chemotherapy in frail patients with refractory lymphoma. MTX-HOPE has been reported to be effective against T-cell tumors. Severe nonhematologic adverse events are rarely reported; however, bone marrow suppression is commonly observed.

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: t-cell prolymphocytic leukemia [ICD-11: 2A90.0] [1]

• Sensitive Disease: t-cell prolymphocytic leukemia [ICD-11: 2A90.0]
• Sensitive Drug: Vincristine
• Molecule Alteration: Expressiom; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vivo Model: T-cell prolymphocytic leukemia patient; Homo sapiens
• Experiment for Molecule Alteration: Flow cytometry
• Experiment for Drug Resistance: Overall survival assay
• Mechanism Description: MTX-HOPE is a combination of classical chemotherapy agents originally developed for palliative chemotherapy in frail patients with refractory lymphoma. MTX-HOPE has been reported to be effective against T-cell tumors. Severe nonhematologic adverse events are rarely reported; however, bone marrow suppression is commonly observed.

References

• Ref 1: Methotrexate, Hydrocortisone, Vincristine, Sobuzoxane, and Etoposide Is an Effective Option for Relapsed T-cell Prolymphocytic Leukemia with Loss of CD52 Expression after Retreatment with Alemtuzumab. JMA J. 2024 Oct 15;7(4):642-645.