General Information of the Molecule (ID: Mol04357)
Name
CAMPATH-1 antigen (CD52) ,Homo sapiens
Synonyms
CDw52; Cambridge pathology 1 antigen; Epididymal secretory protein E5; Human epididymis-specific protein 5; CD_antigen=CD52
    Click to Show/Hide
Molecule Type
Protein
Gene Name
CD52
Gene ID
1043
Sequence
MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCF
S
    Click to Show/Hide
Function
May play a role in carrying and orienting carbohydrate, aswell as having a more specific role.
    Click to Show/Hide
Uniprot ID
CD52_HUMAN
Ensembl ID
ENSG000001694429
HGNC ID
HGNC:1804
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
Drug Resistance Data Categorized by Drug
Approved Drug(s)
7 drug(s) in total
Click to Show/Hide the Full List of Drugs
Cyclophosphamide
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: t-cell prolymphocytic leukemia [ICD-11: 2A90.0] [1]
Resistant Disease t-cell prolymphocytic leukemia [ICD-11: 2A90.0]
Resistant Drug Cyclophosphamide
Molecule Alteration Expressiom
L747S
Experimental Note Identified from the Human Clinical Data
In Vivo Model T-cell prolymphocytic leukemia patient Homo sapiens
Experiment for
Molecule Alteration
Flow cytometry
Experiment for
Drug Resistance
Overall survival assay
Mechanism Description MTX-HOPE is a combination of classical chemotherapy agents originally developed for palliative chemotherapy in frail patients with refractory lymphoma. MTX-HOPE has been reported to be effective against T-cell tumors. Severe nonhematologic adverse events are rarely reported; however, bone marrow suppression is commonly observed.
Etoposide
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: t-cell prolymphocytic leukemia [ICD-11: 2A90.0] [1]
Sensitive Disease t-cell prolymphocytic leukemia [ICD-11: 2A90.0]
Sensitive Drug Etoposide
Molecule Alteration Expressiom
Down-regulation
Experimental Note Identified from the Human Clinical Data
In Vivo Model T-cell prolymphocytic leukemia patient Homo sapiens
Experiment for
Molecule Alteration
Flow cytometry
Experiment for
Drug Resistance
Overall survival assay
Mechanism Description MTX-HOPE is a combination of classical chemotherapy agents originally developed for palliative chemotherapy in frail patients with refractory lymphoma. MTX-HOPE has been reported to be effective against T-cell tumors. Severe nonhematologic adverse events are rarely reported; however, bone marrow suppression is commonly observed.
Hydrocortisone
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: t-cell prolymphocytic leukemia [ICD-11: 2A90.0] [1]
Sensitive Disease t-cell prolymphocytic leukemia [ICD-11: 2A90.0]
Sensitive Drug Hydrocortisone
Molecule Alteration Expressiom
Down-regulation
Experimental Note Identified from the Human Clinical Data
In Vivo Model T-cell prolymphocytic leukemia patient Homo sapiens
Experiment for
Molecule Alteration
Flow cytometry
Experiment for
Drug Resistance
Overall survival assay
Mechanism Description MTX-HOPE is a combination of classical chemotherapy agents originally developed for palliative chemotherapy in frail patients with refractory lymphoma. MTX-HOPE has been reported to be effective against T-cell tumors. Severe nonhematologic adverse events are rarely reported; however, bone marrow suppression is commonly observed.
Methotrexate
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: t-cell prolymphocytic leukemia [ICD-11: 2A90.0] [1]
Sensitive Disease t-cell prolymphocytic leukemia [ICD-11: 2A90.0]
Sensitive Drug Methotrexate
Molecule Alteration Expressiom
Down-regulation
Experimental Note Identified from the Human Clinical Data
In Vivo Model T-cell prolymphocytic leukemia patient Homo sapiens
Experiment for
Molecule Alteration
Flow cytometry
Experiment for
Drug Resistance
Overall survival assay
Mechanism Description MTX-HOPE is a combination of classical chemotherapy agents originally developed for palliative chemotherapy in frail patients with refractory lymphoma. MTX-HOPE has been reported to be effective against T-cell tumors. Severe nonhematologic adverse events are rarely reported; however, bone marrow suppression is commonly observed.
Tofacitinib
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: t-cell prolymphocytic leukemia [ICD-11: 2A90.0] [1]
Resistant Disease t-cell prolymphocytic leukemia [ICD-11: 2A90.0]
Resistant Drug Tofacitinib
Molecule Alteration Expressiom
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vivo Model T-cell prolymphocytic leukemia patient Homo sapiens
Experiment for
Molecule Alteration
Flow cytometry
Experiment for
Drug Resistance
Overall survival assay
Mechanism Description MTX-HOPE is a combination of classical chemotherapy agents originally developed for palliative chemotherapy in frail patients with refractory lymphoma. MTX-HOPE has been reported to be effective against T-cell tumors. Severe nonhematologic adverse events are rarely reported; however, bone marrow suppression is commonly observed.
Venetoclax
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: t-cell prolymphocytic leukemia [ICD-11: 2A90.0] [1]
Resistant Disease t-cell prolymphocytic leukemia [ICD-11: 2A90.0]
Resistant Drug Venetoclax
Molecule Alteration Expressiom
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vivo Model T-cell prolymphocytic leukemia patient Homo sapiens
Experiment for
Molecule Alteration
Flow cytometry
Experiment for
Drug Resistance
Overall survival assay
Mechanism Description MTX-HOPE is a combination of classical chemotherapy agents originally developed for palliative chemotherapy in frail patients with refractory lymphoma. MTX-HOPE has been reported to be effective against T-cell tumors. Severe nonhematologic adverse events are rarely reported; however, bone marrow suppression is commonly observed.
Vincristine
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: t-cell prolymphocytic leukemia [ICD-11: 2A90.0] [1]
Resistant Disease t-cell prolymphocytic leukemia [ICD-11: 2A90.0]
Resistant Drug Vincristine
Molecule Alteration Expressiom
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vivo Model T-cell prolymphocytic leukemia patient Homo sapiens
Experiment for
Molecule Alteration
Flow cytometry
Experiment for
Drug Resistance
Overall survival assay
Mechanism Description MTX-HOPE is a combination of classical chemotherapy agents originally developed for palliative chemotherapy in frail patients with refractory lymphoma. MTX-HOPE has been reported to be effective against T-cell tumors. Severe nonhematologic adverse events are rarely reported; however, bone marrow suppression is commonly observed.
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: t-cell prolymphocytic leukemia [ICD-11: 2A90.0] [1]
Sensitive Disease t-cell prolymphocytic leukemia [ICD-11: 2A90.0]
Sensitive Drug Vincristine
Molecule Alteration Expressiom
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vivo Model T-cell prolymphocytic leukemia patient Homo sapiens
Experiment for
Molecule Alteration
Flow cytometry
Experiment for
Drug Resistance
Overall survival assay
Mechanism Description MTX-HOPE is a combination of classical chemotherapy agents originally developed for palliative chemotherapy in frail patients with refractory lymphoma. MTX-HOPE has been reported to be effective against T-cell tumors. Severe nonhematologic adverse events are rarely reported; however, bone marrow suppression is commonly observed.
References
Ref 1 Methotrexate, Hydrocortisone, Vincristine, Sobuzoxane, and Etoposide Is an Effective Option for Relapsed T-cell Prolymphocytic Leukemia with Loss of CD52 Expression after Retreatment with Alemtuzumab. JMA J. 2024 Oct 15;7(4):642-645.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.