Molecule Information

General Information of the Molecule (ID: Mol04329)

• Name: Histone H1.4 (H1-4) ,Homo sapiens
• Synonyms: Histone H1b; Histone H1s-4
• Molecule Type: Protein
• Gene Name: H1-4
• Gene ID: 3008
• Sequence:
  MSETAPAAPAAPAPAEKTPVKKKARKSAGAAKRKASGPPVSELITKAVAASKERSGVSLA
  ALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPK
  A KKAGAAKAKKPAGAAKKPKKATGAATPKKSAKKTPKKAKKPAAAAGAKKAKSPKKAKA
  AK PKKAPKSPAKAKAVKPKAAKPKTAKPKAAKPKKAAAKKK
• Function: Histone H1 protein binds to linker DNA between nucleosomesforming the macromolecular structure known as the chromatin fiber.Histones H1 are necessary for the condensation of nucleosome chainsinto higher-order structured fibers. Also acts as a regulator ofindividual gene transcription through chromatin remodeling, nucleosomespacing and DNA methylation . {ECO:0000250}.
• Uniprot ID: H14_HUMAN
• Ensembl ID: ENSG000001682987
• HGNC ID: HGNC:4718

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  EADR: Epigenetic Alteration of DNA, RNA or Protein

Drug Resistance Data Categorized by Drug

Approved Drug(s) 2 drug(s) in total

Docetaxel

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Epigenetic Alteration of DNA, RNA or Protein (EADR)

Disease Class: Oesophagus adenocarcinoma [ICD-11: 2B70.0] [1]

• Resistant Disease: Oesophagus adenocarcinoma [ICD-11: 2B70.0]
• Resistant Drug: Docetaxel
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vivo Model: Patient-derived esophageal cancer model; Homo sapiens
• Experiment for Molecule Alteration: Gene expression analysis
• Experiment for Drug Resistance: Drug sensitivity analysis
• Mechanism Description: The results of drug sensitivity of risk genes showed that the high expression of HIST1H1E made tumor cells resistant to trametinib, selumetinib, RDEA119, Docetaxel and 17-AAG. The high expression of UBE2C makes tumor cells resistant to masitinib. The low expression of ERO1B makes the EC more sensitive to FK866

Trametinib

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Epigenetic Alteration of DNA, RNA or Protein (EADR)

Disease Class: Oesophagus adenocarcinoma [ICD-11: 2B70.0] [1]

• Resistant Disease: Oesophagus adenocarcinoma [ICD-11: 2B70.0]
• Resistant Drug: Trametinib
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vivo Model: Patient-derived esophageal cancer model; Homo sapiens
• Experiment for Molecule Alteration: Gene expression analysis
• Experiment for Drug Resistance: Drug sensitivity analysis
• Mechanism Description: The results of drug sensitivity of risk genes showed that the high expression of HIST1H1E made tumor cells resistant to trametinib, selumetinib, RDEA119, Docetaxel and 17-AAG. The high expression of UBE2C makes tumor cells resistant to masitinib. The low expression of ERO1B makes the EC more sensitive to FK866

Clinical Trial Drug(s) 3 drug(s) in total

Refametinib

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Epigenetic Alteration of DNA, RNA or Protein (EADR)

Disease Class: Oesophagus adenocarcinoma [ICD-11: 2B70.0] [1]

• Resistant Disease: Oesophagus adenocarcinoma [ICD-11: 2B70.0]
• Resistant Drug: Refametinib
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vivo Model: Patient-derived esophageal cancer model; Homo sapiens
• Experiment for Molecule Alteration: Gene expression analysis
• Experiment for Drug Resistance: Drug sensitivity analysis
• Mechanism Description: The results of drug sensitivity of risk genes showed that the high expression of HIST1H1E made tumor cells resistant to trametinib, selumetinib, RDEA119, Docetaxel and 17-AAG. The high expression of UBE2C makes tumor cells resistant to masitinib. The low expression of ERO1B makes the EC more sensitive to FK866

Selumetinib

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Epigenetic Alteration of DNA, RNA or Protein (EADR)

Disease Class: Oesophagus adenocarcinoma [ICD-11: 2B70.0] [1]

• Resistant Disease: Oesophagus adenocarcinoma [ICD-11: 2B70.0]
• Resistant Drug: Selumetinib
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vivo Model: Patient-derived esophageal cancer model; Homo sapiens
• Experiment for Molecule Alteration: Gene expression analysis
• Experiment for Drug Resistance: Drug sensitivity analysis
• Mechanism Description: The results of drug sensitivity of risk genes showed that the high expression of HIST1H1E made tumor cells resistant to trametinib, selumetinib, RDEA119, Docetaxel and 17-AAG. The high expression of UBE2C makes tumor cells resistant to masitinib. The low expression of ERO1B makes the EC more sensitive to FK866

Tanespimycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Epigenetic Alteration of DNA, RNA or Protein (EADR)

Disease Class: Oesophagus adenocarcinoma [ICD-11: 2B70.0] [1]

• Resistant Disease: Oesophagus adenocarcinoma [ICD-11: 2B70.0]
• Resistant Drug: Tanespimycin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vivo Model: Patient-derived esophageal cancer model; Homo sapiens
• Experiment for Molecule Alteration: Gene expression analysis
• Experiment for Drug Resistance: Drug sensitivity analysis
• Mechanism Description: The results of drug sensitivity of risk genes showed that the high expression of HIST1H1E made tumor cells resistant to trametinib, selumetinib, RDEA119, Docetaxel and 17-AAG. The high expression of UBE2C makes tumor cells resistant to masitinib. The low expression of ERO1B makes the EC more sensitive to FK866

References

• Ref 1: Establishment of prognostic risk model and drug sensitivity based on prognostic related genes of esophageal cancer. Sci Rep. 2022 May 14;12(1):8008.