Molecule Information

General Information of the Molecule (ID: Mol04101)

• Name: Cytochrome P450 family 1 subfamily B member 1 (CYP1B1) ,Homo sapiens
• Molecule Type: Protein
• Gene Name: CYP1B1
• Location: chr2:38066973-38109902[-]
• Sequence:
  MGTSLSPNDPWPLNPLSIQQTTLLLLLSVLATVHVGQRLLRQRRRQLRSAPPGPFAWPLI
  GNAAAVGQAAHLSFARLARRYGDVFQIRLGSCPIVVLNGERAIHQALVQQGSAFADRPAF
  ASFRVVSGGRSMAFGHYSEHWKV
• Uniprot ID: A0A087WUQ7_HUMAN
• Ensembl ID: ENSG00000138061
• HGNC ID: HGNC:2597

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  MRAP: Metabolic Reprogramming via Altered Pathways

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Cytarabine

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Metabolic Reprogramming via Altered Pathways (MRAP)

Disease Class: Acute myeloid leukemia [ICD-11: 2A60.0] [1]

• Metabolic Type: Mitochondrial metabolism
• Resistant Disease: Acute myeloid leukemia [ICD-11: 2A60.0]
• Resistant Drug: Cytarabine
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• Cell Pathway Regulation: Cushing syndrome; Activation; hsa04934
• In Vitro Model: SHI-1 cells; Bone marrow; Homo sapiens (Human); CVCL_2191
• In Vitro Model: Skm1 cells; Blood; Homo sapiens (Human); CVCL_0098
• In Vitro Model: U937 cells; Blood; Homo sapiens (Human); CVCL_0007
• Experiment for Molecule Alteration: Western blot analysis
• Experiment for Drug Resistance: Cell viability assay
• Mechanism Description: The data analysis reveals that the AHR signaling pathway is activated in AML patients. Furthermore, there is a correlation between the expressions of AHR and mitochondrial oxidative phosphorylation genes.In vitroexperiments show that enhancing AHR expression in AML cells increases mitochondrial oxidative phosphorylation and induces resistance to cytarabine. Conversely, reducing AHR expression in AML cells decreases cytarabine resistance.

References

• Ref 1: AHR signaling pathway mediates mitochondrial oxidative phosphorylation which leads to cytarabine resistance. Acta Biochim Biophys Sin (Shanghai). 2024 Apr 25;56(4):597-606.