Molecule Information

General Information of the Molecule (ID: Mol04006)

• Name: COP9 signalosome subunit 6 (CSN6) ,Drosophila melanogaster
• Molecule Type: Protein
• Gene Name: CSN6
• Gene ID: 42661
• Sequence:
  MEQMEVDVDMSAKPSTSSSAAAGSSMAVDKTADQNPQPQGNIMAAAGTSGSVTISLHPLV
  IMNISEHWTRFRAQHGEPRQVYGALIGKQKGRNIEIMNSFELKTDVIGDETVINKDYYNK
  KEQQYKQVFSDLDFIGWYTTGDNPTADDIKIQRQIAAINECPIMLQLNPLSRSVDHLPLK
  LFESLIDLVDGEATMLFVPLTYTLATEEAERIGVDHVARMTSNESGEKSVVAEHLVAQDS
  AIKMLNTRIKIVLQYIRDVEAGKLRANQEILREAYALCHRLPVMQVPAFQEEFYTQCNDV
  GLISYLGTLTKGCNDMHHFVNKFNMLYDRQGSARRMRGLYY
• 3D-structure: PDB ID: 4E0Q; Classification: Unknown function; Method: X-ray diffraction; Resolution: 2.50 Å
• Function: Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. The CSN complex plays an essential role in oogenesis and embryogenesis and is required for proper photoreceptor R cell differentiation and promote lamina glial cell migration or axon targeting. It also promotes Ubl-dependent degradation of cyclin E (CycE) during early oogenesis. .
• Uniprot ID: CSN6_DROME

Kingdom: Metazoa
Phylum: Arthropoda
Class: Insecta
Order: Diptera
Family: Drosophilidae
Genus: Drosophila
Species: Drosophila melanogaster

Type(s) of Resistant Mechanism of This Molecule

  MRAP: Metabolic Reprogramming via Altered Pathways

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Fluorouracil

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Metabolic Reprogramming via Altered Pathways (MRAP)

Disease Class: Colorectal cancer [ICD-11: 2B91.1] [1]

• Metabolic Type: Nucleic acid metabolism
• Resistant Disease: Colorectal cancer [ICD-11: 2B91.1]
• Resistant Drug: Fluorouracil
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• In Vivo Model: NU/NU nude mice and C57BL/6 mice, with fresh tissue from patient; Mice
• Experiment for Molecule Alteration: qRT-PCR
• Experiment for Drug Resistance: Tumor volume assay
• Mechanism Description: In accordance with these findings, we demonstrated that DDX5 bound to PHGDH mRNA and stimulated its expression by suppressing mRNA degradation in colorectal cancer.

References

• Ref 1: CSN6 Mediates Nucleotide Metabolism to Promote Tumor Development and Chemoresistance in Colorectal Cancer. Cancer Res. 2023 Feb 3;83(3):414-427.