Molecule Information

General Information of the Molecule (ID: Mol02124)

• Name: Siderophore export accessory protein MmpS5 (mmpS5) ,Mycobacteroides abscessus
• Synonyms: Siderophore export accessory protein MmpS5; mmpS5; Rv0677c; MTV040.05c
• Molecule Type: Protein
• Gene Name: mmpS5
• Gene ID: 888233
• Sequence:
  MIGTLKRAWIPLLILVVVAIAGFTVQRIRTFFGSEGILVTPKVFADDPEPFDPKVVEYEV
  SGSGSYVNINYLDLDAKPQRIDGAALPWSLTLKTTAPSAAPNILAQGDGTSITCRITVDG
  EVKDERTATGVDALTYCFVKSA
• Function: Part of an export system, which is required for biosynthesis and secretion of siderophores. Essential for virulence.
• Uniprot ID: MMPS5_MYCTU

Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Corynebacteriales
Family: Mycobacteriaceae
Genus: Mycobacteroides
Species: Mycobacteroides abscessus

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Thiacetazone

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Mycobacterium abscessus infection [1]

• Resistant Disease: Mycobacterium abscessus infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Thiacetazone
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Mycobacterium abscessus strain CIP104536T; 36809
• In Vitro Model: Mycobacterium bolletii strain CIP108541T; 319705
• In Vitro Model: Mycobacterium massiliense strain CIP108297T; 319705
• Experiment for Molecule Alteration: Whole-genome sequencing assay
• Experiment for Drug Resistance: Microdilution method
• Mechanism Description: Importantly, mutations in the transcriptional TetR repressor MAB_4384, with concomitant upregulation of the divergently oriented adjacent genes encoding an MmpS5/MmpL5 efflux pump system, accounted for high cross-resistance levels among all three compounds.

References

• Ref 1: Resistance to Thiacetazone Derivatives Active against Mycobacterium abscessus Involves Mutations in the MmpL5 Transcriptional Repressor MAB_4384 .Antimicrob Agents Chemother. 2017 Mar 24;61(4):e02509-16. doi: 10.1128/AAC.02509-16. Print 2017 Apr. 10.1128/AAC.02509-16