General Information of the Molecule (ID: Mol02124)
Name
Siderophore export accessory protein MmpS5 (mmpS5) ,Mycobacteroides abscessus
Synonyms
Siderophore export accessory protein MmpS5; mmpS5; Rv0677c; MTV040.05c
    Click to Show/Hide
Molecule Type
Protein
Gene Name
mmpS5
Gene ID
888233
Sequence
MIGTLKRAWIPLLILVVVAIAGFTVQRIRTFFGSEGILVTPKVFADDPEPFDPKVVEYEV
SGSGSYVNINYLDLDAKPQRIDGAALPWSLTLKTTAPSAAPNILAQGDGTSITCRITVDG
EVKDERTATGVDALTYCFVKSA
    Click to Show/Hide
Function
Part of an export system, which is required for biosynthesis and secretion of siderophores. Essential for virulence.
    Click to Show/Hide
Uniprot ID
MMPS5_MYCTU
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Corynebacteriales
Family: Mycobacteriaceae
Genus: Mycobacteroides
Species: Mycobacteroides abscessus
Type(s) of Resistant Mechanism of This Molecule
  IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Thiacetazone
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Mycobacterium abscessus infection [ICD-11: 1A00-1C4Z] [1]
Resistant Disease Mycobacterium abscessus infection [ICD-11: 1A00-1C4Z]
Resistant Drug Thiacetazone
Molecule Alteration Expression
Up-regulation
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Mycobacterium abscessus strain CIP104536T 36809
Mycobacterium bolletii strain CIP108541T 319705
Mycobacterium massiliense strain CIP108297T 319705
Experiment for
Molecule Alteration
Whole-genome sequencing assay
Experiment for
Drug Resistance
Microdilution method
Mechanism Description Importantly, mutations in the transcriptional TetR repressor MAB_4384, with concomitant upregulation of the divergently oriented adjacent genes encoding an MmpS5/MmpL5 efflux pump system, accounted for high cross-resistance levels among all three compounds.
References
Ref 1 Resistance to Thiacetazone Derivatives Active against Mycobacterium abscessus Involves Mutations in the MmpL5 Transcriptional Repressor MAB_4384 .Antimicrob Agents Chemother. 2017 Mar 24;61(4):e02509-16. doi: 10.1128/AAC.02509-16. Print 2017 Apr. 10.1128/AAC.02509-16

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.