Molecule Information
General Information of the Molecule (ID: Mol02124)
Name |
Siderophore export accessory protein MmpS5 (mmpS5)
,Mycobacteroides abscessus
|
||||
---|---|---|---|---|---|
Synonyms |
Siderophore export accessory protein MmpS5; mmpS5; Rv0677c; MTV040.05c
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
mmpS5
|
||||
Gene ID | |||||
Sequence |
MIGTLKRAWIPLLILVVVAIAGFTVQRIRTFFGSEGILVTPKVFADDPEPFDPKVVEYEV
SGSGSYVNINYLDLDAKPQRIDGAALPWSLTLKTTAPSAAPNILAQGDGTSITCRITVDG EVKDERTATGVDALTYCFVKSA Click to Show/Hide
|
||||
Function |
Part of an export system, which is required for biosynthesis and secretion of siderophores. Essential for virulence.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Mycobacterium abscessus infection | [1] | |||
Resistant Disease | Mycobacterium abscessus infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Thiacetazone | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Mycobacterium abscessus strain CIP104536T | 36809 | ||
Mycobacterium bolletii strain CIP108541T | 319705 | |||
Mycobacterium massiliense strain CIP108297T | 319705 | |||
Experiment for Molecule Alteration |
Whole-genome sequencing assay | |||
Experiment for Drug Resistance |
Microdilution method | |||
Mechanism Description | Importantly, mutations in the transcriptional TetR repressor MAB_4384, with concomitant upregulation of the divergently oriented adjacent genes encoding an MmpS5/MmpL5 efflux pump system, accounted for high cross-resistance levels among all three compounds. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.