Molecule Information

General Information of the Molecule (ID: Mol02124)

Name	Siderophore export accessory protein MmpS5 (mmpS5) ,Mycobacteroides abscessus
Synonyms	Siderophore export accessory protein MmpS5; mmpS5; Rv0677c; MTV040.05c Click to Show/Hide
Molecule Type	Protein
Gene Name	mmpS5
Gene ID	888233
Sequence	MIGTLKRAWIPLLILVVVAIAGFTVQRIRTFFGSEGILVTPKVFADDPEPFDPKVVEYEV SGSGSYVNINYLDLDAKPQRIDGAALPWSLTLKTTAPSAAPNILAQGDGTSITCRITVDG EVKDERTATGVDALTYCFVKSA Click to Show/Hide
Function	Part of an export system, which is required for biosynthesis and secretion of siderophores. Essential for virulence. Click to Show/Hide
Uniprot ID	MMPS5_MYCTU
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Actinobacteria Class: Actinomycetia Order: Corynebacteriales Family: Mycobacteriaceae Genus: Mycobacteroides Species: Mycobacteroides abscessus

Type(s) of Resistant Mechanism of This Molecule

IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Thiacetazone

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Irregularity in Drug Uptake and Drug Efflux (IDUE)		Click to Show/Hide
Disease Class: Mycobacterium abscessus infection [ICD-11: 1A00-1C4Z]			[1]
Resistant Disease	Mycobacterium abscessus infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Thiacetazone		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Mycobacterium abscessus strain CIP104536T		36809
	Mycobacterium bolletii strain CIP108541T		319705
	Mycobacterium massiliense strain CIP108297T		319705
Experiment for Molecule Alteration	Whole-genome sequencing assay
Experiment for Drug Resistance	Microdilution method
Mechanism Description	Importantly, mutations in the transcriptional TetR repressor MAB_4384, with concomitant upregulation of the divergently oriented adjacent genes encoding an MmpS5/MmpL5 efflux pump system, accounted for high cross-resistance levels among all three compounds.

References

Ref 1	Resistance to Thiacetazone Derivatives Active against Mycobacterium abscessus Involves Mutations in the MmpL5 Transcriptional Repressor MAB_4384 .Antimicrob Agents Chemother. 2017 Mar 24;61(4):e02509-16. doi: 10.1128/AAC.02509-16. Print 2017 Apr. 10.1128/AAC.02509-16