Molecule Information
General Information of the Molecule (ID: Mol02100)
Name |
Prostaglandin G/H synthase 2 (Cox-2)
,Mus musculus
|
||||
---|---|---|---|---|---|
Synonyms |
Prostaglandin G/H synthase 2 (EC 1.14.99.1) (Cyclooxygenase-2) (COX-2) (Glucocorticoid-regulated inflammatory cyclooxygenase) (Gripghs) (Macrophage activation-associated marker protein P71/73) (PES-2) (PHS II) (Prostaglandin H2 synthase 2) (PGH synthase 2) (PGHS-2) (Prostaglandin-endoperoxide synthase 2) (TIS10 protein); Ptgs2; Cox-2; Cox2; Pghs-b; Tis10
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
Cox-2
|
||||
Gene ID | |||||
Location |
Chromosome 1: 149,975,782-149,983,978 forward strand
|
||||
Sequence |
MLFRAVLLCAALGLSQAANPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFL
TRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRSLIMKYVLTSRSYLIDSPPTYNVHY GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDPQGS NMMFAFFAQHFTHQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKY QVIGGEVYPPTVKDTQVEMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHNRVCD ILKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ NRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFTRQIAGRV AGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKAL YSDIDVMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEV GFKIINTASIQSLICNNVKGCPFTSFNVQDPQPTKTATINASASHSRLDDINPTVLIKRR STEL Click to Show/Hide
|
||||
Function |
Electrogenic Na(+)-coupled sugar simporter that actively transports D-glucose at the plasma membrane, with a Na(+) to sugar coupling ratio of 1:1. Transporter activity is driven by a transmembrane Na(+) electrochemical gradient set by the Na(+)/K(+) pump. Has a primary role in D-glucose reabsorption from glomerular filtrate across the brush border of the early proximal tubules of the kidney.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Rheumatoid arthritis | [1] | |||
Resistant Disease | Rheumatoid arthritis [ICD-11: FA20.0] | |||
Resistant Drug | Valdecoxib | |||
Molecule Alteration | Function | Inhibition |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
In Vitro Model | Hela cells | Cervix uteri | Homo sapiens (Human) | CVCL_0030 |
In Vivo Model | Standard diet fed male C57BL/6J (B6) mouse model; HFD fed male C57BL/6J (B6) mouse model | Mus musculus | ||
Experiment for Molecule Alteration |
Enzyme linked immunosorbent assay; Western blotting analysis | |||
Mechanism Description | Valdecoxib improves lipid-induced skeletal muscle insulin resistance via simultaneous suppression of inflammation and endoplasmic reticulum stress. | |||
Disease Class: Osteoarthritis | [1] | |||
Resistant Disease | Osteoarthritis [ICD-11: FB84.2] | |||
Resistant Drug | Valdecoxib | |||
Molecule Alteration | Function | Inhibition |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
In Vitro Model | Hela cells | Cervix uteri | Homo sapiens (Human) | CVCL_0030 |
In Vivo Model | Standard diet fed male C57BL/6J (B6) mouse model; HFD fed male C57BL/6J (B6) mouse model | Mus musculus | ||
Experiment for Molecule Alteration |
Enzyme linked immunosorbent assay; Western blotting analysis | |||
Mechanism Description | Valdecoxib improves lipid-induced skeletal muscle insulin resistance via simultaneous suppression of inflammation and endoplasmic reticulum stress. | |||
Disease Class: Dysmenorrhea | [1] | |||
Resistant Disease | Dysmenorrhea [ICD-11: GA34.3] | |||
Resistant Drug | Valdecoxib | |||
Molecule Alteration | Function | Inhibition |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
In Vitro Model | Hela cells | Cervix uteri | Homo sapiens (Human) | CVCL_0030 |
In Vivo Model | Standard diet fed male C57BL/6J (B6) mouse model; HFD fed male C57BL/6J (B6) mouse model | Mus musculus | ||
Experiment for Molecule Alteration |
Enzyme linked immunosorbent assay; Western blotting analysis | |||
Mechanism Description | Valdecoxib improves lipid-induced skeletal muscle insulin resistance via simultaneous suppression of inflammation and endoplasmic reticulum stress. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.