Molecule Information

General Information of the Molecule (ID: Mol02046)

• Name: D-alanine--D-alanine ligase (Q5MPQ2) ,Enterococcus faecium
• Synonyms: vanB; ddl
• Molecule Type: Protein
• Gene Name: Q5MPQ2
• Sequence:
  MNRIKVAIIFGGCSEEHDVSVKSAIEIAANIDTEKFDPHYIGITKNGVWKLCKKPCTEWE
  ADSLPAILSPDRKTHGLLVMKESEYETRRIDVAFPVLHGKCGEDGAIQGLFVLSGIPYVG
  CDIQSSAACMDKSLAYILTKNAGIAVPEFQIIDKGDKPEAGALTYPVFVKPARSGSSFGV
  TKVNGTEELNAAIEAAGQYDGKILIEQAISGCEVGCAVMGNEDDLIVGEVDQIRLSHGIF
  RIHQENEPEKGSENAMITVPADIPVEERNRVQETAKKVYRVLGCRGLARVDLFLQEDGGI
  VLNEVNTMPGFTSYSRYPRMVAAAGITLPALIDSLITLALKR
• Function: Cell wall formation.
• Uniprot ID: Q5MPQ2_ENTFC

Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: 186826
Family: Enterococcaceae
Genus: Enterococcus
Species: Enterococcus faecium

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Thiethylperazine

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Lactobacillus casei infection [1]

• Sensitive Disease: Lactobacillus casei infection [ICD-11: 1A00-1C4Z]
• Sensitive Drug: Thiethylperazine
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Enterococcus faecium strain; 1352
• In Vitro Model: Streptococcus faecium strain; 1352
• Experiment for Drug Resistance: agar dilution method
• Mechanism Description: Resistance to vancomycin in enterococci is mainly caused by expression of enzymes such as ligase, dehydrogenase, carboxypeptidase and carboxypeptidase which are encoded by genes such as vanA and vanB. Phenothiazines such as chlorpromazine are well known to deactivate a large number of enzymes. The reversal of vancomycin resistance may be due to enzyme inactivation.

References

• Ref 1: Enhancement of vancomycin activity by phenothiazines against vancomycin-resistant Enterococcus faecium in vitro .Basic Clin Pharmacol Toxicol. 2010 Aug;107(2):676-9. doi: 10.1111/j.1742-7843.2010.00558.x. Epub 2010 Mar 28. 10.1111/j.1742-7843.2010.00558.x