Molecule Information

General Information of the Molecule (ID: Mol02045)

• Name: Beta-lactamase (Q6QJ55) ,Pseudomonas aeruginosa
• Synonyms: blaoxa-10; bla1; blaOXA-10; OXA-10; oxa-10; oxa10; E5D53_33915; GUL26_37150; PA52Ts2_0147
• Molecule Type: Protein
• Gene Name: Q6QJ55
• Sequence:
  MKTFAAYVIIACLSSTALAGSITENTSWNKEFSAEAVNGVFVLCKSSSKSCATNDLARAS
  KEYLPASTFKIPNAIIGLETGVIKNEHQVFKWDGKPRAMKQWERDLTLRGAIQVSAVPVF
  QQIAREVGEVRMQKYLKKFSYGNQNISGGIDKFWLEGQLRISAVNQVEFLESLYLNKLSA
  SKENQLIVKEALVTEAAPEYLVHSKTGFSGVGTESNPGVAWWVGWVEKETEVYFFAFNMD
  IDNESKLPLRKSIPTKIMESEGIIGG
• Uniprot ID: Q6QJ55_PSEAI

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: 72274
Family: Pseudomonadaceae
Genus: Pseudomonas
Species: Pseudomonas aeruginosa

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Tazobactam

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Carbapenem-nonsusceptible Pseudomonas aeruginosa infection [1]

• Resistant Disease: Carbapenem-nonsusceptible Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Tazobactam
• Molecule Alteration: Function; Inhibition
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Carbapenem-nonsusceptible Pseudomonas aeruginosa strain; 287
• Experiment for Molecule Alteration: Whole-genome sequencing assay
• Mechanism Description: Ceftolozane/tazobactam (C/T), a novel beta-lactam/beta-lactamase inhibitor combination, addresses an unmet medical need in patients with these multidrug-resistant P. aeruginosa infections.

References

• Ref 1: Ceftolozane/Tazobactam Resistance and Mechanisms in Carbapenem-Nonsusceptible Pseudomonas aeruginosa .mSphere. 2021 Jan 27;6(1):e01026-20. doi: 10.1128/mSphere.01026-20. 10.1128/mSphere.01026-20