General Information of the Molecule (ID: Mol02022)
Name
Beta-lactamase (Q9X4S7) ,Prevotella intermedia
Synonyms
cfxA2; CLI70_02470; CTI18_10205; CTM44_04660; CTM46_08920; CTM50_00090; CTM53_10840; CTM59_09130; CTM62_10610; CUB95_12895; CUB97_12180
    Click to Show/Hide
Molecule Type
Protein
Gene Name
Q9X4S7
Gene ID
57246820
Sequence
MEKNRKKQIVVLSIALVCIFILVFSLFHKSATKDSANPPLTNVLTDSISQIVSACPGEIG
VAVIVNNRDTVKVNNKSVYPMMSVFKVHQALALCNDFDNKGISLDTLVNINRDKLDPKTW
SPMLKDYSGPVISLTVRDLLRYTLTQSDNNASNLMFKDMVNVAQTDSFIATLIPRSSFQI
AYTEEEMSADHNKAYSNYTSPLGAAMLMNRLFTEGLIDDEKQSFIKNTLKECKTGVDRIA
APLLDKEGVVIAHKTGSGYVNENGVLAAHNDVAYICLPNNISYTLAVFVKDFKGNESQAS
QYVAHISAVVYSLLMQTSVKS
    Click to Show/Hide
Uniprot ID
Q9X4S7_PREIN
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Bacteroidetes
Class: Bacteroidia
Order: Bacteroidales
Family: Prevotellaceae
Genus: Prevotella
Species: Prevotella intermedia
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
Click to Show/Hide the Full List of Drugs
Amoxicillin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Chronic periodontitis [1]
Resistant Disease Chronic periodontitis [ICD-11: DA0C.Y]
Resistant Drug Amoxicillin
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Prevotella nigrescens strain 28133
Experiment for
Molecule Alteration
PCR
Experiment for
Drug Resistance
Disc diffusion test
Mechanism Description Seventy five percent of patients carried two species of beta-lactamase-producing anaerobic bacteria that comprised 9.4% of the total number of cultivable bacteria. Fifty one percent of beta-lactamase-producing strains mainly Prevotella, Porphyromonas, and Bacteroides carried the cfxA gene, whereas none of them carried blaTEM. Further characterization of the cfxA gene showed that 76.7% of these strains carried the cfxA2 gene, 14% carried cfxA3, and 9.3% carried cfxA6. The cfxA6 gene was present in three Prevotella spp. and in one Porphyromonas spp. Strains containing cfxA genes (56%) were resistant to the beta-lactam antibiotics.
Disease Class: Chronic periodontitis [1]
Resistant Disease Chronic periodontitis [ICD-11: DA0C.Y]
Resistant Drug Amoxicillin
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Porphyromonas gingivalis strain 837
Experiment for
Molecule Alteration
PCR
Experiment for
Drug Resistance
Disc diffusion test
Mechanism Description Seventy five percent of patients carried two species of beta-lactamase-producing anaerobic bacteria that comprised 9.4% of the total number of cultivable bacteria. Fifty one percent of beta-lactamase-producing strains mainly Prevotella, Porphyromonas, and Bacteroides carried the cfxA gene, whereas none of them carried blaTEM. Further characterization of the cfxA gene showed that 76.7% of these strains carried the cfxA2 gene, 14% carried cfxA3, and 9.3% carried cfxA6. The cfxA6 gene was present in three Prevotella spp. and in one Porphyromonas spp. Strains containing cfxA genes (56%) were resistant to the beta-lactam antibiotics.
Ampicillin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Chronic periodontitis [1]
Resistant Disease Chronic periodontitis [ICD-11: DA0C.Y]
Resistant Drug Ampicillin
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Prevotella nigrescens strain 28133
Experiment for
Molecule Alteration
PCR
Experiment for
Drug Resistance
Disc diffusion test
Mechanism Description Seventy five percent of patients carried two species of beta-lactamase-producing anaerobic bacteria that comprised 9.4% of the total number of cultivable bacteria. Fifty one percent of beta-lactamase-producing strains mainly Prevotella, Porphyromonas, and Bacteroides carried the cfxA gene, whereas none of them carried blaTEM. Further characterization of the cfxA gene showed that 76.7% of these strains carried the cfxA2 gene, 14% carried cfxA3, and 9.3% carried cfxA6. The cfxA6 gene was present in three Prevotella spp. and in one Porphyromonas spp. Strains containing cfxA genes (56%) were resistant to the beta-lactam antibiotics.
Disease Class: Chronic periodontitis [1]
Resistant Disease Chronic periodontitis [ICD-11: DA0C.Y]
Resistant Drug Ampicillin
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Porphyromonas gingivalis strain 837
Experiment for
Molecule Alteration
PCR
Experiment for
Drug Resistance
Disc diffusion test
Mechanism Description Seventy five percent of patients carried two species of beta-lactamase-producing anaerobic bacteria that comprised 9.4% of the total number of cultivable bacteria. Fifty one percent of beta-lactamase-producing strains mainly Prevotella, Porphyromonas, and Bacteroides carried the cfxA gene, whereas none of them carried blaTEM. Further characterization of the cfxA gene showed that 76.7% of these strains carried the cfxA2 gene, 14% carried cfxA3, and 9.3% carried cfxA6. The cfxA6 gene was present in three Prevotella spp. and in one Porphyromonas spp. Strains containing cfxA genes (56%) were resistant to the beta-lactam antibiotics.
Penicillin V
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Chronic periodontitis [1]
Resistant Disease Chronic periodontitis [ICD-11: DA0C.Y]
Resistant Drug Penicillin V
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Prevotella nigrescens strain 28133
Experiment for
Molecule Alteration
PCR
Experiment for
Drug Resistance
Disc diffusion test
Mechanism Description Seventy five percent of patients carried two species of beta-lactamase-producing anaerobic bacteria that comprised 9.4% of the total number of cultivable bacteria. Fifty one percent of beta-lactamase-producing strains mainly Prevotella, Porphyromonas, and Bacteroides carried the cfxA gene, whereas none of them carried blaTEM. Further characterization of the cfxA gene showed that 76.7% of these strains carried the cfxA2 gene, 14% carried cfxA3, and 9.3% carried cfxA6. The cfxA6 gene was present in three Prevotella spp. and in one Porphyromonas spp. Strains containing cfxA genes (56%) were resistant to the beta-lactam antibiotics.
Disease Class: Chronic periodontitis [1]
Resistant Disease Chronic periodontitis [ICD-11: DA0C.Y]
Resistant Drug Penicillin V
Molecule Alteration Expression
Inherence
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Porphyromonas gingivalis strain 837
Experiment for
Molecule Alteration
PCR
Experiment for
Drug Resistance
Disc diffusion test
Mechanism Description Seventy five percent of patients carried two species of beta-lactamase-producing anaerobic bacteria that comprised 9.4% of the total number of cultivable bacteria. Fifty one percent of beta-lactamase-producing strains mainly Prevotella, Porphyromonas, and Bacteroides carried the cfxA gene, whereas none of them carried blaTEM. Further characterization of the cfxA gene showed that 76.7% of these strains carried the cfxA2 gene, 14% carried cfxA3, and 9.3% carried cfxA6. The cfxA6 gene was present in three Prevotella spp. and in one Porphyromonas spp. Strains containing cfxA genes (56%) were resistant to the beta-lactam antibiotics.
References
Ref 1 Detection of cfxA2, cfxA3, and cfxA6 genes in beta-lactamase producing oral anaerobes .J Appl Oral Sci. 2016 Apr;24(2):142-7. doi: 10.1590/1678-775720150469. 10.1590/1678-775720150469
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.