Molecule Information
General Information of the Molecule (ID: Mol02012)
Name |
multidrug resistance regulator 2 (MRR2)
,Candida albicans
|
||||
---|---|---|---|---|---|
Synonyms |
MRR2; ZCF34; CAALFM_C307860CA; CaO19.6182
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
MRR2
|
||||
Gene ID | |||||
Sequence |
MTKRDRTIYSCDACRSRKIKCNRQTPCASCHKSKRDCVYTVSRQRDAQITNRKLDKKTYH
QISAIEKKISALEGKKGLLQVETINFNKSFTDQTPLVELQSLFPYLLLSKQDPGCVLVRH HCHHLLEKDPRYFEYSQLLADLSLTKRHHLTARAKALLGEAYIPSPQEGHTIDQLKHVLS LNPNFRFAGNFADPLTSFFSLIPPAWANKQLVDTFFQHIYPVIPIIDETDFNTSINRVLG PQIDGHYINSFPSIGSADDLPFLALFLLVLRISYMYTPGACPVSYDTLRAAETIMKEFDI TKTHSLTALQAEIMLRFYKIVAPESYTQSNYVQVSVGVLIQNCYSLALHRDPEYIGEHNP KQQHLRRKIWHLLLRMEVIDSAIFQTILSSNPDASDTKLPQLIDQAPPMEQSIVKHIWRS TDLFVSLRKLVEINSKTSEDTPLETVLELLVEVETKLQAFLATIDSEASTVFYNDLVIFS VNFLLVYMYYSLYLFKGPTPLGNKYLLKSAQILFVDLARTRSTSLFLAYFNLNYIHLVLM ITNFLRMRVDCIIHRHLRAQDSSVQDLQCCRYFLKIIFFSHVKELGNYSSSHKYAWQMRK VYLTLAKIMERSSDVLISNDPELVKSAAVDIPVKEINKLLEQYINFKGFTPTTLFDPTDN ELIDEMQHENLWNAMENIEYSEKVYSGWIDAIKNVPSNWDWDYWDFLKIS Click to Show/Hide
|
||||
Function |
Transcription factor that controls the expression of CDR1, the major multidrug efflux pump. Required for yeast cell adherence to silicone substrate and plays a role in virulence.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Vulvovaginal candidiasis | [1] | |||
Resistant Disease | Vulvovaginal candidiasis [ICD-11: 1F23.1] | |||
Resistant Drug | Fluconazole | |||
Molecule Alteration | Missense mutation | p.T83A |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Candida albicans isolates | 5476 | ||
Candida albicans ATCC 11006 | 5476 | |||
Candida parapsilosis ATCC 22019 | 5480 | |||
Candida krusei ATCC 6258 | 4909 | |||
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
Broth dilution method assay | |||
Mechanism Description | Efflux pumps including Cdr1 also have been demonstrated as important molecular mechanisms responsible for fluconazole resistance by actively transporting the drug out of the cell.he Mrr2 gene mutation might cause fluconazole resistance through Cdr1 upregulation. | |||
Disease Class: Vulvovaginal candidiasis | [1] | |||
Resistant Disease | Vulvovaginal candidiasis [ICD-11: 1F23.1] | |||
Resistant Drug | Fluconazole | |||
Molecule Alteration | Missense mutation | p.T386I |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Candida albicans isolates | 5476 | ||
Candida albicans ATCC 11006 | 5476 | |||
Candida parapsilosis ATCC 22019 | 5480 | |||
Candida krusei ATCC 6258 | 4909 | |||
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
Broth dilution method assay | |||
Mechanism Description | Efflux pumps including Cdr1 also have been demonstrated as important molecular mechanisms responsible for fluconazole resistance by actively transporting the drug out of the cell.he Mrr2 gene mutation might cause fluconazole resistance through Cdr1 upregulation. | |||
Disease Class: Vulvovaginal candidiasis | [1] | |||
Resistant Disease | Vulvovaginal candidiasis [ICD-11: 1F23.1] | |||
Resistant Drug | Fluconazole | |||
Molecule Alteration | Missense mutation | p.S466L |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Candida albicans isolates | 5476 | ||
Candida albicans ATCC 11006 | 5476 | |||
Candida parapsilosis ATCC 22019 | 5480 | |||
Candida krusei ATCC 6258 | 4909 | |||
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
Broth dilution method assay | |||
Mechanism Description | Efflux pumps including Cdr1 also have been demonstrated as important molecular mechanisms responsible for fluconazole resistance by actively transporting the drug out of the cell.he Mrr2 gene mutation might cause fluconazole resistance through Cdr1 upregulation. | |||
Disease Class: Vulvovaginal candidiasis | [1] | |||
Resistant Disease | Vulvovaginal candidiasis [ICD-11: 1F23.1] | |||
Resistant Drug | Fluconazole | |||
Molecule Alteration | Missense mutation | p.H31Y |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Candida albicans isolates | 5476 | ||
Candida albicans ATCC 11006 | 5476 | |||
Candida parapsilosis ATCC 22019 | 5480 | |||
Candida krusei ATCC 6258 | 4909 | |||
Experiment for Molecule Alteration |
qRT-PCR | |||
Experiment for Drug Resistance |
Broth dilution method assay | |||
Mechanism Description | Efflux pumps including Cdr1 also have been demonstrated as important molecular mechanisms responsible for fluconazole resistance by actively transporting the drug out of the cell.he Mrr2 gene mutation might cause fluconazole resistance through Cdr1 upregulation. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.