General Information of the Molecule (ID: Mol01860)
Name
Cytochrome P450 family 2 subfamily C member 19 (CYP2C19) ,Homo sapiens
Synonyms
CYP2C19
    Click to Show/Hide
Molecule Type
Protein
Gene Name
CYP2C19
Gene ID
1557
Location
chr10:94,762,681-94,855,547[+]
Sequence
MDPFVVLVLCLSCLLLLSIWRQSSGRGKLPPGPTPLPVIGNILQIDIKDVSKSLTNLSKI
YGPVFTLYFGLERMVVLHGYEVVKEALIDLGEEFSGRGHFPLAERANRGFGIVFSNGKRW
KEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICS
IIFQKRFDYKDQQFLNLMEKLNENIRIVSTPWIQICNNFPTIIDYFPGTHNKLLKNLAFM
ESDILEKVKEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTE
TTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYID
LIPTSLPHAVTCDVKFRNYLIPKGTTILTSLTSVLHDNKEFPNPEMFDPRHFLDEGGNFK
KSNYFMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKDLDTTPVVNGFASVP
PFYQLCFIPV
    Click to Show/Hide
3D-structure
PDB ID
4GQS
Classification
Oxidoreductase
Method
X-ray diffraction
Resolution
2.87  Å
Function
A cytochrome P450 monooxygenase involved in the metabolism of polyunsaturated fatty acids (PUFA). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase). Catalyzes the hydroxylation of carbon-hydrogen bonds. Hydroxylates PUFA specifically at the omega-1 position. Catalyzes the epoxidation of double bonds of PUFA. Also metabolizes plant monoterpenes such as limonene. Oxygenates (R)- and (S)-limonene to produce carveol and perillyl alcohol. Responsible for the metabolism of a number of therapeutic agents such as the anticonvulsant drug S-mephenytoin, omeprazole, proguanil, certain barbiturates, diazepam, propranolol, citalopram and imipramine. Hydroxylates fenbendazole at the 4' position.
    Click to Show/Hide
Uniprot ID
CP2CJ_HUMAN
Ensembl ID
ENSG00000165841
HGNC ID
HGNC:2621
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Clopidogrel
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Drug Inactivation by Structure Modification (DISM) Click to Show/Hide
Disease Class: Coronary artery disease [ICD-11: BA8Z.0] [1]
Resistant Disease Coronary artery disease [ICD-11: BA8Z.0]
Resistant Drug Clopidogrel
Molecule Alteration SNP
CYP2C19*2
Experimental Note Identified from the Human Clinical Data
In Vitro Model Blood sample N.A.
Experiment for
Molecule Alteration
Genetic analysis assay
Experiment for
Drug Resistance
Platelet aggregation test assay
Mechanism Description Among the 72 patients studied, 32.6% were carriers of CYP2C19*2 loss-of-function allele. This allele was found to be more common but not significantly so from the controls (27.7%). The loss-of-function genotypes (*2/*2 or *2/*1) of CYP2C19 were seen to be significantly higher in clopidogrel semi-responders compared to responders (72.9% vs 34.3%, P = 0.0023, respectively). Similarly, significantly higher frequency of the mutant *2 allele of CYP2C19 was observed in clopidogrel semi-responders than in responders (43.2% vs 21.4%, P = 0.007).
Disease Class: Acute myocardial infarction [ICD-11: BA41.1] [2]
Resistant Disease Acute myocardial infarction [ICD-11: BA41.1]
Resistant Drug Clopidogrel
Molecule Alteration SNP
CYP2C19*2+CYP2C19*3
Experimental Note Identified from the Human Clinical Data
Mechanism Description We defined CYP2C19*2 and CYP2C19*3 as CYP2C19 loss-of-function alleles (LoFA), indicating possible clopidogrel resistance.
Disease Class: Peripheral arterial disease [ICD-11: BD4Z.0] [3]
Resistant Disease Peripheral arterial disease [ICD-11: BD4Z.0]
Resistant Drug Clopidogrel
Molecule Alteration SNP
.
Experimental Note Identified from the Human Clinical Data
In Vitro Model Whole blood N.A.
Experiment for
Drug Resistance
VerifyNow P2Y12 assay
Mechanism Description Clopidogrel is a pro-drug requiring cytochrome P450 (CYP) 2C19 enzyme to be oxidised to its active form.CYP 2C19 genetic polymorphism may result clopidogrel resistance.
Disease Class: Hypo-attenuated leaflet thickening [ICD-11: BD10.2] [4]
Resistant Disease Hypo-attenuated leaflet thickening [ICD-11: BD10.2]
Resistant Drug Clopidogrel
Molecule Alteration SNP
rs4244285+rs4986893+rs28399504+rs56337013+rs72552267+rs72558186+rs12248560
Experimental Note Identified from the Human Clinical Data
Mechanism Description We thoroughly genotyped 34 SNPs and 8 SNPs that have been reported for clopidogrel and aspirin resistance. A total of 148 patients were enrolled. There were 15 patients demonstrating signs of HALT. Patients with HALT had a higher rate of atrial fibrillation (AF) pre-TAVR (33.3 vs. 7.5%, P = 0.01).
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 11
Click to Show/Hide the Resistance Disease of This Class
Myocardial infarction [ICD-11: BA41]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Peripheral blood
The Specified Disease Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.35E-02; Fold-change: 1.96E-01; Z-score: 4.18E-01
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Coronary artery disease [ICD-11: BA8Z]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Peripheral blood
The Specified Disease Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.83E-01; Fold-change: -8.91E-02; Z-score: -4.03E-01
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Tissue-specific Molecule Abundances in Healthy Individuals
Click to Show/Hide the Molecule Abundances
References
Ref 1 Association of CYP2C19, CYP3A5 and GPIIb/IIIa gene polymorphisms with Aspirin and Clopidogrel Resistance in a cohort of Indian patients with Coronary Artery Disease .Int J Lab Hematol. 2015 Dec;37(6):809-18. doi: 10.1111/ijlh.12416. Epub 2015 Aug 12. 10.1111/ijlh.12416
Ref 2 Assessment of Risk Factors for Drug Resistance of Dual Anti Platelet Therapy After PCI .Clin Appl Thromb Hemost. 2022 Jan-Dec;28:10760296221083674. doi: 10.1177/10760296221083674. 10.1177/10760296221083674
Ref 3 CYP2C19 Polymorphism is Associated With Amputation Rates in Patients Taking Clopidogrel After Endovascular Intervention for Critical Limb Ischaemia .Eur J Vasc Endovasc Surg. 2019 Sep;58(3):373-382. doi: 10.1016/j.ejvs.2019.02.011. Epub 2019 Aug 5. 10.1016/j.ejvs.2019.02.011
Ref 4 Gene polymorphisms in dual antiplatelet therapy and the presence of hypo-attenuated leaflet thickening after transcatheter aortic valve replacement .J Thromb Thrombolysis. 2018 Apr;45(3):463-465. doi: 10.1007/s11239-018-1636-z. 10.1007/s11239-018-1636-z

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.