Molecule Information
General Information of the Molecule (ID: Mol01847)
Name |
Thrombopoietin receptor (TPOR)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
Thrombopoietin receptor; TPO-R; Myeloproliferative leukemia protein; Proto-oncogene c-Mpl; CD antigen CD110; MPL
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
TPOR
|
||||
Gene ID | |||||
Location |
chr1:43,337,818-43,354,466[+]
|
||||
Sequence |
MPSWALFMVTSCLLLAPQNLAQVSSQDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPS
GTYQLLYAYPREKPRACPLSSQSMPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVFLNQTR TQRVLFVDSVGLPAPPSIIKAMGGSQPGELQISWEEPAPEISDFLRYELRYGPRDPKNST GPTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPWQDGPKQTSPSREASALTAEGGS CLISGLQPGNSYWLQLRSEPDGISLGGSWGSWSLPVTVDLPGDAVALGLQCFTLDLKNVT CQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKTNPGLQTPQFSRCHFKSRNDS IIHILVEVTTAPGTVHSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEWQHPSSWAAQE TCYQLRYTGEGHQDWKVLEPPLGARGGTLELRPRSRYRLQLRARLNGPTYQGPWSSWSDP TRVETATETAWISLVTALHLVLGLSAVLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLG QYLRDTAALSPPKATVSDTCEEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLG TMPLSVCPPMAESGSCCTTHIANHSYLPLSYWQQP Click to Show/Hide
|
||||
Function |
Receptor for thrombopoietin that acts as a primary regulator of megakaryopoiesis and platelet production. May represent a regulatory molecule specific for TPO-R-dependent immune responses.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Clinical Trial Drug(s)
2 drug(s) in total
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Myeloproliferative neoplasm | [1] | |||
Sensitive Disease | Myeloproliferative neoplasm [ICD-11: 2A22.0] | |||
Sensitive Drug | BMS-911543 | |||
Molecule Alteration | Missense mutation | p.W515L (c.1544G>T) |
||
Experimental Note | Identified from the Human Clinical Data | |||
Experiment for Molecule Alteration |
Western blotting analysis | |||
Experiment for Drug Resistance |
[3H] thymidine incorporation assay | |||
Mechanism Description | The missense mutation p.W515L (c.1544G>T) in gene MPL cause the sensitivity of BMS-911543 by unusual activation of pro-survival pathway | |||
Disease Class: Hematologic Cancer | [1] | |||
Sensitive Disease | Hematologic Cancer [ICD-11: MG24.Y] | |||
Sensitive Drug | BMS-911543 | |||
Molecule Alteration | Missense mutation | p.W515L (c.1544G>T) |
||
Experimental Note | Identified from the Human Clinical Data | |||
Experiment for Molecule Alteration |
Western blotting analysis | |||
Experiment for Drug Resistance |
[3H] thymidine incorporation assay | |||
Mechanism Description | The missense mutation p.W515L (c.1544G>T) in gene MPL cause the sensitivity of BMS-911543 by unusual activation of pro-survival pathway |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Hematologic Cancer | [2] | |||
Sensitive Disease | Hematologic Cancer [ICD-11: MG24.Y] | |||
Sensitive Drug | NS-018 | |||
Molecule Alteration | Missense mutation | p.W515L (c.1544G>T) |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
In Vitro Model | Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 |
Sf9 cells | Ovary | Homo sapiens (Human) | CVCL_0549 | |
Experiment for Molecule Alteration |
Colony formation assay | |||
Experiment for Drug Resistance |
MTT assay | |||
Mechanism Description | The missense mutation p.W515L (c.1544G>T) in gene MPL cause the sensitivity of NS-018 by unusual activation of pro-survival pathway |
Preclinical Drug(s)
4 drug(s) in total
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Solid tumour/cancer | [3] | |||
Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
Sensitive Drug | BEZ235/Ruxolitinib | |||
Molecule Alteration | Missense mutation | p.W515L (c.1544G>T) |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 |
In Vivo Model | JAK2 mutant Ba/F3 tumour mouse model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blotting analysis | |||
Experiment for Drug Resistance |
CellTiter-Glo assay; Colony assay |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Hematologic Cancer | [4] | |||
Sensitive Disease | Hematologic Cancer [ICD-11: MG24.Y] | |||
Sensitive Drug | CHZ868 | |||
Molecule Alteration | Missense mutation | p.W515L (c.1544G>T) |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | TF-1 cells | Bone marrow | Homo sapiens (Human) | CVCL_0559 |
Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | |
W515L cells | Blood | Homo sapiens (Human) | N.A. | |
SET2 cells | Peripheral blood | Homo sapiens (Human) | CVCL_2187 | |
In Vivo Model | CD45.2 Jak2V617F mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blotting analysis | |||
Experiment for Drug Resistance |
Cell viability luminescent assay | |||
Disease Class: Myeloproliferative neoplasm | [4] | |||
Sensitive Disease | Myeloproliferative neoplasm [ICD-11: 2A22.0] | |||
Sensitive Drug | CHZ868 | |||
Molecule Alteration | Missense mutation | p.W515L (c.1544G>T) |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | TF-1 cells | Bone marrow | Homo sapiens (Human) | CVCL_0559 |
Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | |
W515L cells | Blood | Homo sapiens (Human) | N.A. | |
SET2 cells | Peripheral blood | Homo sapiens (Human) | CVCL_2187 | |
In Vivo Model | CD45.2 Jak2V617F mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blotting analysis | |||
Experiment for Drug Resistance |
Cell viability luminescent assay |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Myeloproliferative neoplasm | [5] | |||
Sensitive Disease | Myeloproliferative neoplasm [ICD-11: 2A22.0] | |||
Sensitive Drug | MK2206 | |||
Molecule Alteration | Missense mutation | p.W515L (c.1544G>T) |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | HEL cells | Blood | Homo sapiens (Human) | CVCL_0001 |
SET2 cells | Peripheral blood | Homo sapiens (Human) | CVCL_2187 | |
In Vivo Model | Balb/c donor mouse xenograft model | Mus musculus | ||
Experiment for Drug Resistance |
Trypan blue staining assay | |||
Mechanism Description | The missense mutation p.W515L (c.1544G>T) in gene MPL cause the sensitivity of MK2206 by unusual activation of pro-survival pathway |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Solid tumour/cancer | [3] | |||
Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
Sensitive Drug | Pictilisib/Ruxolitinib | |||
Molecule Alteration | Missense mutation | p.W515L (c.1544G>T) |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 |
In Vivo Model | JAK2 mutant Ba/F3 tumour mouse model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blotting analysis | |||
Experiment for Drug Resistance |
CellTiter-Glo assay; Colony assay |
Investigative Drug(s)
1 drug(s) in total
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Myeloproliferative neoplasm | [6] | |||
Sensitive Disease | Myeloproliferative neoplasm [ICD-11: 2A22.0] | |||
Sensitive Drug | Pyridone 6 | |||
Molecule Alteration | Missense mutation | p.W515F (c.1544_1545delGGinsTT) |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Bone marrow | . | ||
In Vivo Model | Balb/C donor mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blotting analysis | |||
Experiment for Drug Resistance |
In vitro colony-forming assay | |||
Mechanism Description | The missense mutation p.W515F (c.1544_1545delGGinsTT) in gene MPL cause the sensitivity of JAK inhibitors by unusual activation of pro-survival pathway |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.