General Information of the Molecule (ID: Mol01847)
Name
Thrombopoietin receptor (TPOR) ,Homo sapiens
Synonyms
Thrombopoietin receptor; TPO-R; Myeloproliferative leukemia protein; Proto-oncogene c-Mpl; CD antigen CD110; MPL
    Click to Show/Hide
Molecule Type
Protein
Gene Name
TPOR
Gene ID
4352
Location
chr1:43,337,818-43,354,466[+]
Sequence
MPSWALFMVTSCLLLAPQNLAQVSSQDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPS
GTYQLLYAYPREKPRACPLSSQSMPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVFLNQTR
TQRVLFVDSVGLPAPPSIIKAMGGSQPGELQISWEEPAPEISDFLRYELRYGPRDPKNST
GPTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPWQDGPKQTSPSREASALTAEGGS
CLISGLQPGNSYWLQLRSEPDGISLGGSWGSWSLPVTVDLPGDAVALGLQCFTLDLKNVT
CQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKTNPGLQTPQFSRCHFKSRNDS
IIHILVEVTTAPGTVHSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEWQHPSSWAAQE
TCYQLRYTGEGHQDWKVLEPPLGARGGTLELRPRSRYRLQLRARLNGPTYQGPWSSWSDP
TRVETATETAWISLVTALHLVLGLSAVLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLG
QYLRDTAALSPPKATVSDTCEEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLG
TMPLSVCPPMAESGSCCTTHIANHSYLPLSYWQQP
    Click to Show/Hide
Function
Receptor for thrombopoietin that acts as a primary regulator of megakaryopoiesis and platelet production. May represent a regulatory molecule specific for TPO-R-dependent immune responses.
    Click to Show/Hide
Uniprot ID
TPOR_HUMAN
Ensembl ID
ENSG00000117400
HGNC ID
HGNC:7217
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Clinical Trial Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
BMS-911543
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
       Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Myeloproliferative neoplasm [1]
Sensitive Disease Myeloproliferative neoplasm [ICD-11: 2A22.0]
Sensitive Drug BMS-911543
Molecule Alteration Missense mutation
p.W515L (c.1544G>T)
Experimental Note Identified from the Human Clinical Data
Experiment for
Molecule Alteration
Western blotting analysis
Experiment for
Drug Resistance
[3H] thymidine incorporation assay
Mechanism Description The missense mutation p.W515L (c.1544G>T) in gene MPL cause the sensitivity of BMS-911543 by unusual activation of pro-survival pathway
Disease Class: Hematologic Cancer [1]
Sensitive Disease Hematologic Cancer [ICD-11: MG24.Y]
Sensitive Drug BMS-911543
Molecule Alteration Missense mutation
p.W515L (c.1544G>T)
Experimental Note Identified from the Human Clinical Data
Experiment for
Molecule Alteration
Western blotting analysis
Experiment for
Drug Resistance
[3H] thymidine incorporation assay
Mechanism Description The missense mutation p.W515L (c.1544G>T) in gene MPL cause the sensitivity of BMS-911543 by unusual activation of pro-survival pathway
NS-018
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
       Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Hematologic Cancer [2]
Sensitive Disease Hematologic Cancer [ICD-11: MG24.Y]
Sensitive Drug NS-018
Molecule Alteration Missense mutation
p.W515L (c.1544G>T)
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model Ba/F3 cells Colon Homo sapiens (Human) CVCL_0161
Sf9 cells Ovary Homo sapiens (Human) CVCL_0549
Experiment for
Molecule Alteration
Colony formation assay
Experiment for
Drug Resistance
MTT assay
Mechanism Description The missense mutation p.W515L (c.1544G>T) in gene MPL cause the sensitivity of NS-018 by unusual activation of pro-survival pathway
Preclinical Drug(s)
4 drug(s) in total
Click to Show/Hide the Full List of Drugs
BEZ235/Ruxolitinib
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
       Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Solid tumour/cancer [3]
Sensitive Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Sensitive Drug BEZ235/Ruxolitinib
Molecule Alteration Missense mutation
p.W515L (c.1544G>T)
Experimental Note Identified from the Human Clinical Data
In Vitro Model Ba/F3 cells Colon Homo sapiens (Human) CVCL_0161
In Vivo Model JAK2 mutant Ba/F3 tumour mouse model Mus musculus
Experiment for
Molecule Alteration
Western blotting analysis
Experiment for
Drug Resistance
CellTiter-Glo assay; Colony assay
CHZ868
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
       Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Hematologic Cancer [4]
Sensitive Disease Hematologic Cancer [ICD-11: MG24.Y]
Sensitive Drug CHZ868
Molecule Alteration Missense mutation
p.W515L (c.1544G>T)
Experimental Note Identified from the Human Clinical Data
In Vitro Model TF-1 cells Bone marrow Homo sapiens (Human) CVCL_0559
Ba/F3 cells Colon Homo sapiens (Human) CVCL_0161
W515L cells Blood Homo sapiens (Human) N.A.
SET2 cells Peripheral blood Homo sapiens (Human) CVCL_2187
In Vivo Model CD45.2 Jak2V617F mouse xenograft model Mus musculus
Experiment for
Molecule Alteration
Western blotting analysis
Experiment for
Drug Resistance
Cell viability luminescent assay
Disease Class: Myeloproliferative neoplasm [4]
Sensitive Disease Myeloproliferative neoplasm [ICD-11: 2A22.0]
Sensitive Drug CHZ868
Molecule Alteration Missense mutation
p.W515L (c.1544G>T)
Experimental Note Identified from the Human Clinical Data
In Vitro Model TF-1 cells Bone marrow Homo sapiens (Human) CVCL_0559
Ba/F3 cells Colon Homo sapiens (Human) CVCL_0161
W515L cells Blood Homo sapiens (Human) N.A.
SET2 cells Peripheral blood Homo sapiens (Human) CVCL_2187
In Vivo Model CD45.2 Jak2V617F mouse xenograft model Mus musculus
Experiment for
Molecule Alteration
Western blotting analysis
Experiment for
Drug Resistance
Cell viability luminescent assay
MK2206
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
       Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Myeloproliferative neoplasm [5]
Sensitive Disease Myeloproliferative neoplasm [ICD-11: 2A22.0]
Sensitive Drug MK2206
Molecule Alteration Missense mutation
p.W515L (c.1544G>T)
Experimental Note Identified from the Human Clinical Data
In Vitro Model HEL cells Blood Homo sapiens (Human) CVCL_0001
SET2 cells Peripheral blood Homo sapiens (Human) CVCL_2187
In Vivo Model Balb/c donor mouse xenograft model Mus musculus
Experiment for
Drug Resistance
Trypan blue staining assay
Mechanism Description The missense mutation p.W515L (c.1544G>T) in gene MPL cause the sensitivity of MK2206 by unusual activation of pro-survival pathway
Pictilisib/Ruxolitinib
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
       Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Solid tumour/cancer [3]
Sensitive Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Sensitive Drug Pictilisib/Ruxolitinib
Molecule Alteration Missense mutation
p.W515L (c.1544G>T)
Experimental Note Identified from the Human Clinical Data
In Vitro Model Ba/F3 cells Colon Homo sapiens (Human) CVCL_0161
In Vivo Model JAK2 mutant Ba/F3 tumour mouse model Mus musculus
Experiment for
Molecule Alteration
Western blotting analysis
Experiment for
Drug Resistance
CellTiter-Glo assay; Colony assay
Investigative Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Pyridone 6
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
       Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Myeloproliferative neoplasm [6]
Sensitive Disease Myeloproliferative neoplasm [ICD-11: 2A22.0]
Sensitive Drug Pyridone 6
Molecule Alteration Missense mutation
p.W515F (c.1544_1545delGGinsTT)
Experimental Note Identified from the Human Clinical Data
In Vitro Model Bone marrow .
In Vivo Model Balb/C donor mouse xenograft model Mus musculus
Experiment for
Molecule Alteration
Western blotting analysis
Experiment for
Drug Resistance
In vitro colony-forming assay
Mechanism Description The missense mutation p.W515F (c.1544_1545delGGinsTT) in gene MPL cause the sensitivity of JAK inhibitors by unusual activation of pro-survival pathway
References
Ref 1 Characterization of BMS-911543, a functionally selective small-molecule inhibitor of JAK2Leukemia. 2012 Feb;26(2):280-8. doi: 10.1038/leu.2011.292. Epub 2011 Oct 21.
Ref 2 Efficacy of NS-018, a potent and selective JAK2/Src inhibitor, in primary cells and mouse models of myeloproliferative neoplasmsBlood Cancer J. 2011 Jul;1(7):e29. doi: 10.1038/bcj.2011.29. Epub 2011 Jul 22.
Ref 3 Combination treatment for myeloproliferative neoplasms using JAK and pan-class I PI3K inhibitorsJ Cell Mol Med. 2013 Nov;17(11):1397-409. doi: 10.1111/jcmm.12156. Epub 2013 Nov 19.
Ref 4 CHZ868, a Type II JAK2 Inhibitor, Reverses Type I JAK Inhibitor Persistence and Demonstrates Efficacy in Myeloproliferative NeoplasmsCancer Cell. 2015 Jul 13;28(1):15-28. doi: 10.1016/j.ccell.2015.06.006.
Ref 5 AKT is a therapeutic target in myeloproliferative neoplasmsLeukemia. 2013 Sep;27(9):1882-90. doi: 10.1038/leu.2013.167. Epub 2013 Jun 10.
Ref 6 MPLW515L is a novel somatic activating mutation in myelofibrosis with myeloid metaplasiaPLoS Med. 2006 Jul;3(7):e270. doi: 10.1371/journal.pmed.0030270.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.