Molecule Information
General Information of the Molecule (ID: Mol01836)
| Name |
Fibroblast growth factor receptor 3 (FGFR3)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Fibroblast growth factor receptor 3; FGFR-3; CD antigen CD333; JTK4
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
FGFR3
|
||||
| Gene ID | |||||
| Location |
chr4:1,793,293-1,808,872[+]
|
||||
| Sequence |
MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELS
CPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCH FSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAG NPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQT YTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGP DGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAE EELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKISRFPLK RQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGE GCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIIN LLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQ VARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKW MAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCT HDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSS SSSGDDSVFAHDLLPPAPPSSGGSRT Click to Show/Hide
|
||||
| Function |
Tyrosine-protein kinase that acts as cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of cell proliferation, differentiation and apoptosis. Plays an essential role in the regulation of chondrocyte differentiation, proliferation and apoptosis, and is required for normal skeleton development. Regulates both osteogenesis and postnatal bone mineralization by osteoblasts. Promotes apoptosis in chondrocytes, but can also promote cancer cell proliferation. Required for normal development of the inner ear. Phosphorylates PLCG1, CBL and FRS2. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. Plays a role in the regulation of vitamin D metabolism. Mutations that lead to constitutive kinase activation or impair normal FGFR3 maturation, internalization and degradation lead to aberrant signaling. Over-expressed or constitutively activated FGFR3 promotes activation of PTPN11/SHP2, STAT1, STAT5A and STAT5B. Secreted isoform 3 retains its capacity to bind FGF1 and FGF2 and hence may interfere with FGF signaling.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Transitional cell carcinoma | [1] | |||
| Sensitive Disease | Transitional cell carcinoma [ICD-11: 2C9Z.0] | |||
| Sensitive Drug | Erdafitinib | |||
| Molecule Alteration | Missense mutation | p.S249C (c.746C>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [1] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | Erdafitinib | |||
| Molecule Alteration | Missense mutation | p.G370C (c.1108G>T) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [1] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | Erdafitinib | |||
| Molecule Alteration | Missense mutation | p.Y373C (c.1118A>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [1] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | Erdafitinib | |||
| Molecule Alteration | Missense mutation | p.R248C (c.742C>T) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [2] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | Erdafitinib | |||
| Molecule Alteration | Missense mutation | p.S371C (c.1111A>T) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [2] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | Erdafitinib | |||
| Molecule Alteration | Missense mutation | p.G380R (c.1138G>A) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [2] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | Erdafitinib | |||
| Molecule Alteration | Synonymous | p.K650K (c.1950G>A) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [1] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | Erdafitinib | |||
| Molecule Alteration | Missense mutation | p.G370C (c.1108G>T) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [1] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | Erdafitinib | |||
| Molecule Alteration | Missense mutation | p.Y373C (c.1118A>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [1] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | Erdafitinib | |||
| Molecule Alteration | Missense mutation | p.R248C (c.742C>T) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [1] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | Erdafitinib | |||
| Molecule Alteration | Missense mutation | p.S249C (c.746C>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Transitional cell carcinoma | [1] | |||
| Sensitive Disease | Transitional cell carcinoma [ICD-11: 2C9Z.0] | |||
| Sensitive Drug | Erdafitinib | |||
| Molecule Alteration | Missense mutation | p.G370C (c.1108G>T) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Transitional cell carcinoma | [1] | |||
| Sensitive Disease | Transitional cell carcinoma [ICD-11: 2C9Z.0] | |||
| Sensitive Drug | Erdafitinib | |||
| Molecule Alteration | Missense mutation | p.Y373C (c.1118A>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Transitional cell carcinoma | [1] | |||
| Sensitive Disease | Transitional cell carcinoma [ICD-11: 2C9Z.0] | |||
| Sensitive Drug | Erdafitinib | |||
| Molecule Alteration | Missense mutation | p.R248C (c.742C>T) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Solid tumour/cancer | [3] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | Erdafitinib | |||
| Molecule Alteration | Missense mutation | p.N540K (c.1620C>G) |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | NIH3T3 cells | Embryo | Homo sapiens (Human) | N.A. |
| Experiment for Drug Resistance |
Promega assay | |||
| Disease Class: Bladder cancer | [1] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | Erdafitinib | |||
| Molecule Alteration | Missense mutation | p.S249C (c.746C>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Solid tumour/cancer | [3] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | Erdafitinib | |||
| Molecule Alteration | Missense mutation | p.K650E (c.1948A>G) |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | NIH3T3 cells | Embryo | Homo sapiens (Human) | N.A. |
| Experiment for Drug Resistance |
Promega assay | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Solid tumour/cancer | [4] | |||
| Resistant Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Resistant Drug | Infigratinib | |||
| Molecule Alteration | Missense mutation | p.N540K (c.1620C>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Gallbladder | . | ||
| Experiment for Molecule Alteration |
Targeted sequencing of tumor tissue assay | |||
| Mechanism Description | The missense mutation p.N540K (c.1620C>G) in gene FGFR3 cause the resistance of Infigratinib by aberration of the drug's therapeutic target | |||
| Disease Class: Solid tumour/cancer | [4] | |||
| Resistant Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Resistant Drug | Infigratinib | |||
| Molecule Alteration | Missense mutation | p.V555M (c.1663G>A) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Gallbladder | . | ||
| Experiment for Molecule Alteration |
Targeted sequencing of tumor tissue assay | |||
| Mechanism Description | The missense mutation p.V555M (c.1663G>A) in gene FGFR3 cause the resistance of Infigratinib by aberration of the drug's therapeutic target | |||
| Disease Class: Solid tumour/cancer | [4] | |||
| Resistant Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Resistant Drug | Infigratinib | |||
| Molecule Alteration | Missense mutation | p.V555L (c.1663G>C) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Gallbladder | . | ||
| Experiment for Molecule Alteration |
Targeted sequencing of tumor tissue assay | |||
| Mechanism Description | The missense mutation p.V555L (c.1663G>C) in gene FGFR3 cause the resistance of Infigratinib by aberration of the drug's therapeutic target | |||
| Disease Class: Solid tumour/cancer | [4] | |||
| Resistant Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Resistant Drug | Infigratinib | |||
| Molecule Alteration | Missense mutation | p.L608V (c.1822T>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Gallbladder | . | ||
| Experiment for Molecule Alteration |
Targeted sequencing of tumor tissue assay | |||
| Mechanism Description | The missense mutation p.L608V (c.1822T>G) in gene FGFR3 cause the resistance of Infigratinib by aberration of the drug's therapeutic target | |||
| Disease Class: Solid tumour/cancer | [4] | |||
| Resistant Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Resistant Drug | Infigratinib | |||
| Molecule Alteration | Missense mutation | p.K650E (c.1948A>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Gallbladder | . | ||
| Experiment for Molecule Alteration |
Targeted sequencing of tumor tissue assay | |||
| Mechanism Description | The missense mutation p.K650E (c.1948A>G) in gene FGFR3 cause the resistance of Infigratinib by aberration of the drug's therapeutic target | |||
| Disease Class: Transitional cell carcinoma | [5] | |||
| Resistant Disease | Transitional cell carcinoma [ICD-11: 2C9Z.0] | |||
| Resistant Drug | Infigratinib | |||
| Molecule Alteration | Missense mutation | p.V555M (c.1663G>A) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
|
|
||||
| Disease Class: Head and neck squamous cell carcinoma | [6] | |||
| Resistant Disease | Head and neck squamous cell carcinoma [ICD-11: 2D42.1] | |||
| Resistant Drug | Infigratinib | |||
| Molecule Alteration | Missense mutation | p.S131L (c.392C>T) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | SCC25 cells | Oral | Homo sapiens (Human) | CVCL_1682 |
| HSC3 cells | Tongue | Homo sapiens (Human) | CVCL_1288 | |
| FaDu cells | Pharynx | Homo sapiens (Human) | CVCL_1218 | |
| HN cells | Cervical lymph node | Homo sapiens (Human) | CVCL_1283 | |
| Detroit 562 cells | Pleural effusion | Homo sapiens (Human) | CVCL_1171 | |
| 584-A2 cells | Larynx | Homo sapiens (Human) | CVCL_V278 | |
| Experiment for Molecule Alteration |
Immunohistochemical staining assay; qRT-PCR | |||
| Experiment for Drug Resistance |
MTT assay | |||
| Mechanism Description | In vitro, FGFR3 overexpression led to increased proliferation, whereas migration was not altered. Moreover, FGFR3-overexpressing cells were more sensitive to BGJ398. Cells overexpressing FGFR3 mutant versions showed increased proliferation compared to wild-type FGFR3 under serum-reduced conditions and were largely as sensitive as the wild-type protein to BGJ398. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bladder cancer | [7] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | Infigratinib | |||
| Molecule Alteration | Missense mutation | p.G370C (c.1108G>T) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [7] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | Infigratinib | |||
| Molecule Alteration | Missense mutation | p.Y373C (c.1118A>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [7] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | Infigratinib | |||
| Molecule Alteration | Missense mutation | p.R248C (c.742C>T) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [2] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | Infigratinib | |||
| Molecule Alteration | Missense mutation | p.S371C (c.1111A>T) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [2] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | Infigratinib | |||
| Molecule Alteration | Missense mutation | p.G380R (c.1138G>A) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Solid tumour/cancer | [8] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | Infigratinib | |||
| Molecule Alteration | Missense mutation | p.R248C (c.742C>T) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 |
| NIH-3T3 cells | Embryo | Mus musculus (Mouse) | CVCL_0594 | |
| In Vivo Model | Mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Western blotting analysis | |||
| Experiment for Drug Resistance |
Soft-agar colony formation assay | |||
| Mechanism Description | The missense mutation p.R248C (c.742C>T) in gene FGFR3 cause the sensitivity of Infigratinib by aberration of the drug's therapeutic target | |||
| Disease Class: Bladder cancer | [7] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | Infigratinib | |||
| Molecule Alteration | Missense mutation | p.S249C (c.746C>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [2] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | Infigratinib | |||
| Molecule Alteration | Synonymous | p.K650K (c.1950G>A) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Solid tumour/cancer | [8] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | Infigratinib | |||
| Molecule Alteration | Missense mutation | p.S249C (c.746C>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 |
| NIH-3T3 cells | Embryo | Mus musculus (Mouse) | CVCL_0594 | |
| In Vivo Model | Mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Western blotting analysis | |||
| Experiment for Drug Resistance |
Soft-agar colony formation assay | |||
| Mechanism Description | The missense mutation p.S249C (c.746C>G) in gene FGFR3 cause the sensitivity of Infigratinib by aberration of the drug's therapeutic target | |||
|
|
||||
| Disease Class: Urinary system cancer | [9] | |||
| Sensitive Disease | Urinary system cancer [ICD-11: 2C95.Y] | |||
| Sensitive Drug | Infigratinib | |||
| Molecule Alteration | Missense mutation | p.S249C (c.746C>G) |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | FGF/FGFR signaling pathway | Inhibition | hsa01521 | |
| In Vitro Model | NCI-H716 cells | Colon | Homo sapiens (Human) | CVCL_1581 |
| NCI-H520 cells | Lung | Homo sapiens (Human) | CVCL_1566 | |
| RT112 cells | Bladder | Homo sapiens (Human) | CVCL_1670 | |
| BaF3 cells | Bone | Mus musculus (Mouse) | CVCL_0161 | |
| KG-1 cells | Bone marrow | Homo sapiens (Human) | CVCL_0374 | |
| KATO-3 cells | Gastric | Homo sapiens (Human) | CVCL_0371 | |
| UMUC14 cells | Kidney | Homo sapiens (Human) | CVCL_2747 | |
| SNU16 cells | Ascites | Homo sapiens (Human) | CVCL_0076 | |
| OPM2 cells | Peripheral blood | Homo sapiens (Human) | CVCL_1625 | |
| NCI-H2444 cells | Lung | Homo sapiens (Human) | CVCL_1552 | |
| NCI-H1581 cells | Lung | Homo sapiens (Human) | CVCL_1479 | |
| MFM-223 cells | Pleural effusion | Homo sapiens (Human) | CVCL_1408 | |
| DMS-114 cells | Lung | Homo sapiens (Human) | CVCL_1174 | |
| In Vivo Model | BALB/c nude mouse PDX model | Mus musculus | ||
| Mechanism Description | c-Myc functioned as the key downstream effector that preceded FGFR-MEK/ERK signaling in FGFR aberrant cancer. Disruption of c-Myc overrode the cell proliferation driven by constitutively active FGFR. FGFR inhibition in FGFR-addicted cancer facilitated c-Myc degradation via phosphorylating c-Myc at threonine 58. Ectopic expression of undegradable c-Myc mutant conferred resistance to FGFR inhibition both in vitro and in vivo. c-Myc level alteration stringently determined the response to FGFR inhibitors, as demonstrated in FGFR-responsive cancer subset, as well as cancers bearing acquired or de novo resistance to FGFR inhibition. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Primary pulmonary lymphoepithelioma-like carcinoma | [10] | |||
| Resistant Disease | Primary pulmonary lymphoepithelioma-like carcinoma [ICD-11: 2D4Y.Z] | |||
| Resistant Drug | Nivolumab | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | KB-3-1 cells | Lung | Homo sapiens (Human) | CVCL_2088 |
| Mechanism Description | Pulmonary LELC with FGFR3 gene amplification may not respond well to nivolumab monotherapy. The combination of anlotinib and nivolumab can reverse the resistance to nivolumab in pulmonary LELC with FGFR3 gene amplification. | |||
Clinical Trial Drug(s)
6 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bladder cancer | [11] | |||
| Resistant Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Resistant Drug | Cediranib | |||
| Molecule Alteration | Missense mutation | p.Y375C (c.1124A>G) |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | SUP-M2 cells | Colon | Homo sapiens (Human) | CVCL_2209 |
| KARPAS-299 cells | Peripheral blood | Homo sapiens (Human) | CVCL_1324 | |
| In Vivo Model | mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Western blotting analysis | |||
| Experiment for Drug Resistance |
MTS assay | |||
| Mechanism Description | The missense mutation p.Y375C (c.1124A>G) in gene FGFR3 cause the resistance of Cediranib by unusual activation of pro-survival pathway | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bladder cancer | [11] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | Cediranib | |||
| Molecule Alteration | Missense mutation | p.S249C (c.746C>G) |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | SUP-M2 cells | Colon | Homo sapiens (Human) | CVCL_2209 |
| KARPAS-299 cells | Peripheral blood | Homo sapiens (Human) | CVCL_1324 | |
| In Vivo Model | mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Western blotting analysis | |||
| Experiment for Drug Resistance |
MTS assay | |||
| Mechanism Description | The missense mutation p.S249C (c.746C>G) in gene FGFR3 cause the sensitivity of Cediranib by unusual activation of pro-survival pathway | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bladder cancer | [12] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | Derazantinib | |||
| Molecule Alteration | Missense mutation | p.K652E (c.1954A>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Cell Pathway Regulation | FGF/FGFR signaling pathway | Inhibition | hsa01521 | |
| In Vitro Model | A2780 cells | Ovary | Homo sapiens (Human) | CVCL_0134 |
| KG-1 cells | Bone marrow | Homo sapiens (Human) | CVCL_0374 | |
| J82 cells | Bladder | Homo sapiens (Human) | CVCL_0359 | |
| RT4 cells | Bladder | Homo sapiens (Human) | CVCL_0036 | |
| NCI-H716 cells | Colon | Homo sapiens (Human) | CVCL_1581 | |
| SNU-16 cells | Gastric | Homo sapiens (Human) | CVCL_0076 | |
| AN3CA cells | Ovary | Homo sapiens (Human) | CVCL_0028 | |
| SkOV3 cells | Ovary | Homo sapiens (Human) | CVCL_0532 | |
| K562 cells | Blood | Homo sapiens (Human) | CVCL_0004 | |
| SW780 cells | Bladder | Homo sapiens (Human) | CVCL_1728 | |
| KATO-3 cells | Gastric | Homo sapiens (Human) | CVCL_0371 | |
| RT-112 cells | Urinary bladder | Homo sapiens (Human) | CVCL_1670 | |
| MFM-223 cells | Pleural effusion | Homo sapiens (Human) | CVCL_1408 | |
| MFE296 cells | Endometrium | Homo sapiens (Human) | CVCL_1406 | |
| MFE280 cells | Endometrium | Homo sapiens (Human) | CVCL_1405 | |
| COS-1 cells | Kidney | Chlorocebus aethiops (Green monkey) | CVCL_0223 | |
| In Vivo Model | SCID beige mouse PDX model | Mus musculus | ||
| Experiment for Molecule Alteration |
Western blotting analysis | |||
| Experiment for Drug Resistance |
MTS assay | |||
| Mechanism Description | In cells, inhibition of FGFR2 auto-phosphorylation and other proteins downstream in the FGFR pathway (FRS2alpha, AKT, ERK) was evident by the response to ARQ 087 treatment. Cell proliferation studies demonstrated ARQ 087 has anti-proliferative activity in cell lines driven by FGFR dysregulation, including amplifications, fusions, and mutations. Cell cycle studies in cell lines with high levels of FGFR2 protein showed a positive relationship between ARQ 087 induced G1 cell cycle arrest and subsequent induction of apoptosis. In addition, ARQ 087 was effective at inhibiting tumor growth in vivo in FGFR2 altered, SNU-16 and NCI-H716, xenograft tumor models with gene amplifications and fusions. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Solid tumour/cancer | [4] | |||
| Resistant Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Resistant Drug | AZD-4547 | |||
| Molecule Alteration | Missense mutation | p.L608V (c.1822T>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Gallbladder | . | ||
| Experiment for Molecule Alteration |
Targeted sequencing of tumor tissue assay | |||
| Mechanism Description | The missense mutation p.L608V (c.1822T>G) in gene FGFR3 cause the resistance of AZD-4547 by aberration of the drug's therapeutic target | |||
| Disease Class: Solid tumour/cancer | [3] | |||
| Resistant Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Resistant Drug | AZD-4547 | |||
| Molecule Alteration | Missense mutation | p.K650E (c.1948A>G) |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | NIH3T3 cells | Embryo | Homo sapiens (Human) | N.A. |
| Experiment for Drug Resistance |
Promega assay | |||
| Disease Class: Solid tumour/cancer | [4] | |||
| Resistant Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Resistant Drug | AZD-4547 | |||
| Molecule Alteration | Missense mutation | p.V555M (c.1663G>A) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Gallbladder | . | ||
| Experiment for Molecule Alteration |
Targeted sequencing of tumor tissue assay | |||
| Mechanism Description | The missense mutation p.V555M (c.1663G>A) in gene FGFR3 cause the resistance of AZD-4547 by aberration of the drug's therapeutic target | |||
| Disease Class: Solid tumour/cancer | [3] | |||
| Resistant Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Resistant Drug | AZD-4547 | |||
| Molecule Alteration | Missense mutation | p.N540K (c.1620C>G) |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | NIH3T3 cells | Embryo | Homo sapiens (Human) | N.A. |
| Experiment for Drug Resistance |
Promega assay | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bladder cancer | [7] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | AZD-4547 | |||
| Molecule Alteration | Missense mutation | p.S249C (c.746C>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [2] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | AZD-4547 | |||
| Molecule Alteration | Synonymous | p.K650K (c.1950G>A) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [7] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | AZD-4547 | |||
| Molecule Alteration | Missense mutation | p.G370C (c.1108G>T) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [7] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | AZD-4547 | |||
| Molecule Alteration | Missense mutation | p.Y373C (c.1118A>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [7] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | AZD-4547 | |||
| Molecule Alteration | Missense mutation | p.R248C (c.742C>T) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [2] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | AZD-4547 | |||
| Molecule Alteration | Missense mutation | p.S371C (c.1111A>T) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [2] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | AZD-4547 | |||
| Molecule Alteration | Missense mutation | p.G380R (c.1138G>A) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
|
|
||||
| Disease Class: Urinary system cancer | [9] | |||
| Sensitive Disease | Urinary system cancer [ICD-11: 2C95.Y] | |||
| Sensitive Drug | AZD-4547 | |||
| Molecule Alteration | Missense mutation | p.S249C (c.746C>G) |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | FGF/FGFR signaling pathway | Inhibition | hsa01521 | |
| In Vitro Model | NCI-H716 cells | Colon | Homo sapiens (Human) | CVCL_1581 |
| NCI-H520 cells | Lung | Homo sapiens (Human) | CVCL_1566 | |
| RT112 cells | Bladder | Homo sapiens (Human) | CVCL_1670 | |
| BaF3 cells | Bone | Mus musculus (Mouse) | CVCL_0161 | |
| KG-1 cells | Bone marrow | Homo sapiens (Human) | CVCL_0374 | |
| KATO-3 cells | Gastric | Homo sapiens (Human) | CVCL_0371 | |
| UMUC14 cells | Kidney | Homo sapiens (Human) | CVCL_2747 | |
| SNU16 cells | Ascites | Homo sapiens (Human) | CVCL_0076 | |
| OPM2 cells | Peripheral blood | Homo sapiens (Human) | CVCL_1625 | |
| NCI-H2444 cells | Lung | Homo sapiens (Human) | CVCL_1552 | |
| NCI-H1581 cells | Lung | Homo sapiens (Human) | CVCL_1479 | |
| MFM-223 cells | Pleural effusion | Homo sapiens (Human) | CVCL_1408 | |
| DMS-114 cells | Lung | Homo sapiens (Human) | CVCL_1174 | |
| In Vivo Model | BALB/c nude mouse PDX model | Mus musculus | ||
| Mechanism Description | c-Myc functioned as the key downstream effector that preceded FGFR-MEK/ERK signaling in FGFR aberrant cancer. Disruption of c-Myc overrode the cell proliferation driven by constitutively active FGFR. FGFR inhibition in FGFR-addicted cancer facilitated c-Myc degradation via phosphorylating c-Myc at threonine 58. Ectopic expression of undegradable c-Myc mutant conferred resistance to FGFR inhibition both in vitro and in vivo. c-Myc level alteration stringently determined the response to FGFR inhibitors, as demonstrated in FGFR-responsive cancer subset, as well as cancers bearing acquired or de novo resistance to FGFR inhibition. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Solid tumour/cancer | [4] | |||
| Resistant Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Resistant Drug | DEBIO-1347 | |||
| Molecule Alteration | Missense mutation | p.N540K (c.1620C>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Gallbladder | . | ||
| Experiment for Molecule Alteration |
Targeted sequencing of tumor tissue assay | |||
| Mechanism Description | The missense mutation p.N540K (c.1620C>G) in gene FGFR3 cause the resistance of DEBIO-1347 by aberration of the drug's therapeutic target | |||
| Disease Class: Solid tumour/cancer | [4] | |||
| Resistant Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Resistant Drug | DEBIO-1347 | |||
| Molecule Alteration | Missense mutation | p.V555M (c.1663G>A) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Gallbladder | . | ||
| Experiment for Molecule Alteration |
Targeted sequencing of tumor tissue assay | |||
| Mechanism Description | The missense mutation p.V555M (c.1663G>A) in gene FGFR3 cause the resistance of DEBIO-1347 by aberration of the drug's therapeutic target | |||
| Disease Class: Solid tumour/cancer | [4] | |||
| Resistant Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Resistant Drug | DEBIO-1347 | |||
| Molecule Alteration | Missense mutation | p.L608V (c.1822T>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Gallbladder | . | ||
| Experiment for Molecule Alteration |
Targeted sequencing of tumor tissue assay | |||
| Mechanism Description | The missense mutation p.L608V (c.1822T>G) in gene FGFR3 cause the resistance of DEBIO-1347 by aberration of the drug's therapeutic target | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Bladder cancer | [13] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | DEBIO-1347 | |||
| Molecule Alteration | Missense mutation | p.S249C (c.746C>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | 327 cells | N.A. | . | N.A. |
| In Vivo Model | Female BALB-nu/nu mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Western blotting analysis | |||
| Experiment for Drug Resistance |
CCK-8 assay | |||
| Disease Class: Bladder cancer | [2] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | DEBIO-1347 | |||
| Molecule Alteration | Synonymous | p.K650K (c.1950G>A) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [7] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | DEBIO-1347 | |||
| Molecule Alteration | Missense mutation | p.G370C (c.1108G>T) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [7] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | DEBIO-1347 | |||
| Molecule Alteration | Missense mutation | p.Y373C (c.1118A>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [7] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | DEBIO-1347 | |||
| Molecule Alteration | Missense mutation | p.R248C (c.742C>T) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [2] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | DEBIO-1347 | |||
| Molecule Alteration | Missense mutation | p.S371C (c.1111A>T) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Bladder cancer | [2] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | DEBIO-1347 | |||
| Molecule Alteration | Missense mutation | p.G380R (c.1138G>A) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Myeloproliferative neoplasm | [13] | |||
| Sensitive Disease | Myeloproliferative neoplasm [ICD-11: 2A22.0] | |||
| Sensitive Drug | DEBIO-1347 | |||
| Molecule Alteration | Missense mutation | p.Y373C (c.1118A>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | 327 cells | N.A. | . | N.A. |
| In Vivo Model | Female BALB-nu/nu mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Western blotting analysis | |||
| Experiment for Drug Resistance |
CCK-8 assay | |||
| Disease Class: Myeloproliferative neoplasm | [13] | |||
| Sensitive Disease | Myeloproliferative neoplasm [ICD-11: 2A22.0] | |||
| Sensitive Drug | DEBIO-1347 | |||
| Molecule Alteration | Missense mutation | p.F386L (c.1156T>C) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | 327 cells | N.A. | . | N.A. |
| In Vivo Model | Female BALB-nu/nu mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Western blotting analysis | |||
| Experiment for Drug Resistance |
CCK-8 assay | |||
| Disease Class: Myeloproliferative neoplasm | [13] | |||
| Sensitive Disease | Myeloproliferative neoplasm [ICD-11: 2A22.0] | |||
| Sensitive Drug | DEBIO-1347 | |||
| Molecule Alteration | Missense mutation | p.K650E (c.1948A>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | 327 cells | N.A. | . | N.A. |
| In Vivo Model | Female BALB-nu/nu mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Western blotting analysis | |||
| Experiment for Drug Resistance |
CCK-8 assay | |||
| Disease Class: Bladder cancer | [7] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | DEBIO-1347 | |||
| Molecule Alteration | Missense mutation | p.S249C (c.746C>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Disease Class: Solid tumour/cancer | [4] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | DEBIO-1347 | |||
| Molecule Alteration | Missense mutation | p.K650E (c.1948A>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Gallbladder | . | ||
| Experiment for Molecule Alteration |
Targeted sequencing of tumor tissue assay | |||
| Mechanism Description | The missense mutation p.K650E (c.1948A>G) in gene FGFR3 cause the sensitivity of DEBIO-1347 by aberration of the drug's therapeutic target | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Solid tumour/cancer | [4] | |||
| Resistant Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Resistant Drug | LY-2874455 | |||
| Molecule Alteration | Missense mutation | p.N540K (c.1620C>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Gallbladder | . | ||
| Experiment for Molecule Alteration |
Targeted sequencing of tumor tissue assay | |||
| Mechanism Description | The missense mutation p.N540K (c.1620C>G) in gene FGFR3 cause the resistance of LY-2874455 by aberration of the drug's therapeutic target | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Solid tumour/cancer | [4] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | LY-2874455 | |||
| Molecule Alteration | Missense mutation | p.V555M (c.1663G>A) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Gallbladder | . | ||
| Experiment for Molecule Alteration |
Targeted sequencing of tumor tissue assay | |||
| Mechanism Description | The missense mutation p.V555M (c.1663G>A) in gene FGFR3 cause the sensitivity of LY-2874455 by aberration of the drug's therapeutic target | |||
| Disease Class: Solid tumour/cancer | [4] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | LY-2874455 | |||
| Molecule Alteration | Missense mutation | p.L608V (c.1822T>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Gallbladder | . | ||
| Experiment for Molecule Alteration |
Targeted sequencing of tumor tissue assay | |||
| Mechanism Description | The missense mutation p.L608V (c.1822T>G) in gene FGFR3 cause the sensitivity of LY-2874455 by aberration of the drug's therapeutic target | |||
| Disease Class: Solid tumour/cancer | [4] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | LY-2874455 | |||
| Molecule Alteration | Missense mutation | p.K650E (c.1948A>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Gallbladder | . | ||
| Experiment for Molecule Alteration |
Targeted sequencing of tumor tissue assay | |||
| Mechanism Description | The missense mutation p.K650E (c.1948A>G) in gene FGFR3 cause the sensitivity of LY-2874455 by aberration of the drug's therapeutic target | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Solid tumour/cancer | [14] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | PRN1371 | |||
| Molecule Alteration | Missense mutation | p.K650M (c.1949A>T) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Cell Pathway Regulation | FGF/FGFR signaling pathway | Inhibition | hsa01521 | |
| In Vitro Model | HCT116 cells | Colon | Homo sapiens (Human) | CVCL_0291 |
| Hep3B cells | Liver | Homo sapiens (Human) | CVCL_0326 | |
| RT4 cells | Bladder | Homo sapiens (Human) | CVCL_0036 | |
| NCI-H716 cells | Colon | Homo sapiens (Human) | CVCL_1581 | |
| RT112 cells | Bladder | Homo sapiens (Human) | CVCL_1670 | |
| AN3CA cells | Ovary | Homo sapiens (Human) | CVCL_0028 | |
| Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | |
| SNU878 cells | Liver | Homo sapiens (Human) | CVCL_5102 | |
| SNU16 cells | Ascites | Homo sapiens (Human) | CVCL_0076 | |
| OPM2 cells | Peripheral blood | Homo sapiens (Human) | CVCL_1625 | |
| LI7 cells | Liver | Homo sapiens (Human) | CVCL_3840 | |
| JHH7 cells | Liver | Homo sapiens (Human) | CVCL_2805 | |
| In Vivo Model | Nude mouse PDX model | Mus musculus | ||
| Experiment for Drug Resistance |
Promega assay | |||
| Mechanism Description | PRN1371 exhibits potent and durable pathway inhibition, and robust antiproliferative activity. PRN1371 demonstrates prolonged FGFR inhibition in vivo. | |||
Preclinical Drug(s)
4 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Multiple myeloma | [15] | |||
| Sensitive Disease | Multiple myeloma [ICD-11: 2A83.0] | |||
| Sensitive Drug | E7090 | |||
| Molecule Alteration | Missense mutation | p.Y373C (c.1118A>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Solid tumour/cancer | [4] | |||
| Resistant Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Resistant Drug | FIIN-2 | |||
| Molecule Alteration | Missense mutation | p.N540K (c.1620C>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Gallbladder | . | ||
| Experiment for Molecule Alteration |
Targeted sequencing of tumor tissue assay | |||
| Mechanism Description | The missense mutation p.N540K (c.1620C>G) in gene FGFR3 cause the resistance of FIIN-2 by aberration of the drug's therapeutic target | |||
| Disease Class: Solid tumour/cancer | [4] | |||
| Resistant Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Resistant Drug | FIIN-2 | |||
| Molecule Alteration | Missense mutation | p.V555M (c.1663G>A) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Gallbladder | . | ||
| Experiment for Molecule Alteration |
Targeted sequencing of tumor tissue assay | |||
| Mechanism Description | The missense mutation p.V555M (c.1663G>A) in gene FGFR3 cause the resistance of FIIN-2 by aberration of the drug's therapeutic target | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Solid tumour/cancer | [4] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | FIIN-2 | |||
| Molecule Alteration | Missense mutation | p.K650E (c.1948A>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Gallbladder | . | ||
| Experiment for Molecule Alteration |
Targeted sequencing of tumor tissue assay | |||
| Mechanism Description | The missense mutation p.K650E (c.1948A>G) in gene FGFR3 cause the sensitivity of FIIN-2 by aberration of the drug's therapeutic target | |||
| Disease Class: Solid tumour/cancer | [4] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | FIIN-2 | |||
| Molecule Alteration | Missense mutation | p.L608V (c.1822T>G) |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Gallbladder | . | ||
| Experiment for Molecule Alteration |
Targeted sequencing of tumor tissue assay | |||
| Mechanism Description | The missense mutation p.L608V (c.1822T>G) in gene FGFR3 cause the sensitivity of FIIN-2 by aberration of the drug's therapeutic target | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Solid tumour/cancer | [16] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | R3Mab | |||
| Molecule Alteration | Missense mutation | p.S249C (c.746C>G) |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | RT4 cells | Bladder | Homo sapiens (Human) | CVCL_0036 |
| KMS11 cells | Peripheral blood | Homo sapiens (Human) | CVCL_2989 | |
| RT112 cells | Bladder | Homo sapiens (Human) | CVCL_1670 | |
| Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | |
| UTMC-2 cells | Pleural effusion | Homo sapiens (Human) | CVCL_4802 | |
| TCC-97-7 cells | Bladder | Homo sapiens (Human) | CVCL_8625 | |
| TCC-97-7 cells | Bladder | Homo sapiens (Human) | CVCL_8625 | |
| OPM2 cells | Peripheral blood | Homo sapiens (Human) | CVCL_1625 | |
| In Vivo Model | Female nu/nu mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Immunoblotting assay | |||
| Mechanism Description | The missense mutation p.S249C (c.746C>G) in gene FGFR3 cause the sensitivity of R3Mab by aberration of the drug's therapeutic target | |||
| Disease Class: Bladder cancer | [16] | |||
| Sensitive Disease | Bladder cancer [ICD-11: 2C94.0] | |||
| Sensitive Drug | R3Mab | |||
| Molecule Alteration | Missense mutation | p.S249C (c.746C>G) |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | RT4 cells | Bladder | Homo sapiens (Human) | CVCL_0036 |
| KMS11 cells | Peripheral blood | Homo sapiens (Human) | CVCL_2989 | |
| RT112 cells | Bladder | Homo sapiens (Human) | CVCL_1670 | |
| Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | |
| UTMC-2 cells | Pleural effusion | Homo sapiens (Human) | CVCL_4802 | |
| TCC-97-7 cells | Bladder | Homo sapiens (Human) | CVCL_8625 | |
| TCC-97-7 cells | Bladder | Homo sapiens (Human) | CVCL_8625 | |
| OPM2 cells | Peripheral blood | Homo sapiens (Human) | CVCL_1625 | |
| In Vivo Model | Female nu/nu mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Immunoblotting assay | |||
| Mechanism Description | The missense mutation p.S249C (c.746C>G) in gene FGFR3 cause the sensitivity of R3Mab by aberration of the drug's therapeutic target | |||
| Disease Class: Solid tumour/cancer | [16] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | R3Mab | |||
| Molecule Alteration | Missense mutation | p.G372C (c.1114G>T) |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | RT4 cells | Bladder | Homo sapiens (Human) | CVCL_0036 |
| KMS11 cells | Peripheral blood | Homo sapiens (Human) | CVCL_2989 | |
| RT112 cells | Bladder | Homo sapiens (Human) | CVCL_1670 | |
| Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | |
| UTMC-2 cells | Pleural effusion | Homo sapiens (Human) | CVCL_4802 | |
| TCC-97-7 cells | Bladder | Homo sapiens (Human) | CVCL_8625 | |
| TCC-97-7 cells | Bladder | Homo sapiens (Human) | CVCL_8625 | |
| OPM2 cells | Peripheral blood | Homo sapiens (Human) | CVCL_1625 | |
| In Vivo Model | Female nu/nu mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Immunoblotting assay | |||
| Mechanism Description | The missense mutation p.G372C (c.1114G>T) in gene FGFR3 cause the sensitivity of R3Mab by aberration of the drug's therapeutic target | |||
| Disease Class: Solid tumour/cancer | [16] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | R3Mab | |||
| Molecule Alteration | Missense mutation | p.Y375C (c.1124A>G) |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | RT4 cells | Bladder | Homo sapiens (Human) | CVCL_0036 |
| KMS11 cells | Peripheral blood | Homo sapiens (Human) | CVCL_2989 | |
| RT112 cells | Bladder | Homo sapiens (Human) | CVCL_1670 | |
| Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | |
| UTMC-2 cells | Pleural effusion | Homo sapiens (Human) | CVCL_4802 | |
| TCC-97-7 cells | Bladder | Homo sapiens (Human) | CVCL_8625 | |
| TCC-97-7 cells | Bladder | Homo sapiens (Human) | CVCL_8625 | |
| OPM2 cells | Peripheral blood | Homo sapiens (Human) | CVCL_1625 | |
| In Vivo Model | Female nu/nu mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Immunoblotting assay | |||
| Mechanism Description | The missense mutation p.Y375C (c.1124A>G) in gene FGFR3 cause the sensitivity of R3Mab by aberration of the drug's therapeutic target | |||
| Disease Class: Solid tumour/cancer | [16] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | R3Mab | |||
| Molecule Alteration | Missense mutation | p.K652E (c.1954A>G) |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | RT4 cells | Bladder | Homo sapiens (Human) | CVCL_0036 |
| KMS11 cells | Peripheral blood | Homo sapiens (Human) | CVCL_2989 | |
| RT112 cells | Bladder | Homo sapiens (Human) | CVCL_1670 | |
| Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | |
| UTMC-2 cells | Pleural effusion | Homo sapiens (Human) | CVCL_4802 | |
| TCC-97-7 cells | Bladder | Homo sapiens (Human) | CVCL_8625 | |
| TCC-97-7 cells | Bladder | Homo sapiens (Human) | CVCL_8625 | |
| OPM2 cells | Peripheral blood | Homo sapiens (Human) | CVCL_1625 | |
| In Vivo Model | Female nu/nu mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Immunoblotting assay | |||
| Mechanism Description | The missense mutation p.K652E (c.1954A>G) in gene FGFR3 cause the sensitivity of R3Mab by aberration of the drug's therapeutic target | |||
| Disease Class: Solid tumour/cancer | [16] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | R3Mab | |||
| Molecule Alteration | Missense mutation | p.R248C (c.742C>T) |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | RT4 cells | Bladder | Homo sapiens (Human) | CVCL_0036 |
| KMS11 cells | Peripheral blood | Homo sapiens (Human) | CVCL_2989 | |
| RT112 cells | Bladder | Homo sapiens (Human) | CVCL_1670 | |
| Ba/F3 cells | Colon | Homo sapiens (Human) | CVCL_0161 | |
| UTMC-2 cells | Pleural effusion | Homo sapiens (Human) | CVCL_4802 | |
| TCC-97-7 cells | Bladder | Homo sapiens (Human) | CVCL_8625 | |
| TCC-97-7 cells | Bladder | Homo sapiens (Human) | CVCL_8625 | |
| OPM2 cells | Peripheral blood | Homo sapiens (Human) | CVCL_1625 | |
| In Vivo Model | Female nu/nu mouse xenograft model | Mus musculus | ||
| Experiment for Molecule Alteration |
Immunoblotting assay | |||
| Mechanism Description | The missense mutation p.R248C (c.742C>T) in gene FGFR3 cause the sensitivity of R3Mab by aberration of the drug's therapeutic target | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Myeloproliferative neoplasm | [17] | |||
| Sensitive Disease | Myeloproliferative neoplasm [ICD-11: 2A22.0] | |||
| Sensitive Drug | SU5402 | |||
| Molecule Alteration | Missense mutation | p.K650E (c.1948A>G) |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | Blood vessel | . | ||
| Experiment for Molecule Alteration |
Mass spectrum assay | |||
| Experiment for Drug Resistance |
CellTiter 96 aqueous one solution cell proliferation assay | |||
| Mechanism Description | The missense mutation p.K650E (c.1948A>G) in gene FGFR3 cause the sensitivity of SU5402 by aberration of the drug's therapeutic target | |||
Investigative Drug(s)
1 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Solid tumour/cancer | [18] | |||
| Sensitive Disease | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||
| Sensitive Drug | PD98059 | |||
| Molecule Alteration | Missense mutation | p.K650E (c.1948A>G) |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | NIH-3T3 cells | Embryo | Mus musculus (Mouse) | CVCL_0594 |
| COS-1 cells | Kidney | Chlorocebus aethiops (Green monkey) | CVCL_0223 | |
| Experiment for Molecule Alteration |
Immunoprecipitation and immunoblot analysis | |||
| Mechanism Description | The missense mutation p.K650E (c.1948A>G) in gene FGFR3 cause the sensitivity of PD98059 by unusual activation of pro-survival pathway | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specified Disease | Multiple myeloma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 6.39E-16; Fold-change: 3.84E-02; Z-score: 3.90E-01 | |
|
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Peripheral blood | |
| The Specified Disease | Multiple myeloma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.19E-01; Fold-change: -4.66E-02; Z-score: -5.74E-01 | |
|
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Bladder tissue | |
| The Specified Disease | Bladder cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.53E-02; Fold-change: -6.43E-01; Z-score: -9.59E-01 | |
|
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
|
||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
