Molecule Information
General Information of the Molecule (ID: Mol01185)
Name |
23S ribosomal RNA methyltransferase Erm34 (ERM34)
,Bacillus clausii
|
||||
---|---|---|---|---|---|
Molecule Type |
Protein
|
||||
Gene Name |
Erm(34)
|
||||
Sequence |
MTKKMNKYNGKKLSRGEPPNFSGQHFMHNKRLLKEIVDKADVSVRDTVLELGAGKGALTT
ILSERADRVLAVEYDQKCIEALQWKLVGSKNVSILHQDIMKVALPTEPFVVVSNIPYSIT TAIMKMLLNNPKNKLQRGAIVMEKGAAKRFTSVSPKDAYVMAWHMWFDIHYERGISRSSF SPPPKVDSALVRIVRKQHPLFPYKEAKAMHDFLSYALNNPRAPLDQVLRGIFTAPQAKKV RQAIGVKPETPVAMLHARQWAMVCDAMVRHVPKVYWPRRKR Click to Show/Hide
|
||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
5 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacillus clausii infection | [1] | |||
Resistant Disease | Bacillus clausii infection [ICD-11: 1C4Y.1] | |||
Resistant Drug | Clindamycin | |||
Molecule Alteration | Methylation | Ribosomal methylation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Bacillus clausii ATCC 21536 | 79880 | ||
Experiment for Molecule Alteration |
Cloning experiments and gene seqencing assay | |||
Experiment for Drug Resistance |
Agar dilution assay | |||
Mechanism Description | This pattern of resistance generally due to the presence of an erm gene encoding a ribosomal methylase. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacillus clausii infection | [1] | |||
Resistant Disease | Bacillus clausii infection [ICD-11: 1C4Y.1] | |||
Resistant Drug | Erythromycin | |||
Molecule Alteration | Methylation | Ribosomal methylation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Bacillus clausii ATCC 21536 | 79880 | ||
Experiment for Molecule Alteration |
Cloning experiments and gene seqencing assay | |||
Experiment for Drug Resistance |
Agar dilution assay | |||
Mechanism Description | This pattern of resistance generally due to the presence of an erm gene encoding a ribosomal methylase. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacillus clausii infection | [1] | |||
Resistant Disease | Bacillus clausii infection [ICD-11: 1C4Y.1] | |||
Resistant Drug | Lincomycin | |||
Molecule Alteration | Methylation | Ribosomal methylation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Bacillus clausii ATCC 21536 | 79880 | ||
Experiment for Molecule Alteration |
Cloning experiments and gene seqencing assay | |||
Experiment for Drug Resistance |
Agar dilution assay | |||
Mechanism Description | This pattern of resistance generally due to the presence of an erm gene encoding a ribosomal methylase. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacillus clausii infection | [1] | |||
Resistant Disease | Bacillus clausii infection [ICD-11: 1C4Y.1] | |||
Resistant Drug | Spiramycin | |||
Molecule Alteration | Methylation | Ribosomal methylation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Bacillus clausii ATCC 21536 | 79880 | ||
Experiment for Molecule Alteration |
Cloning experiments and gene seqencing assay | |||
Experiment for Drug Resistance |
Agar dilution assay | |||
Mechanism Description | This pattern of resistance generally due to the presence of an erm gene encoding a ribosomal methylase. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacillus clausii infection | [1] | |||
Resistant Disease | Bacillus clausii infection [ICD-11: 1C4Y.1] | |||
Resistant Drug | Zithromax | |||
Molecule Alteration | Methylation | Ribosomal methylation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Bacillus clausii ATCC 21536 | 79880 | ||
Experiment for Molecule Alteration |
Cloning experiments and gene seqencing assay | |||
Experiment for Drug Resistance |
Agar dilution assay | |||
Mechanism Description | This pattern of resistance generally due to the presence of an erm gene encoding a ribosomal methylase. |
Clinical Trial Drug(s)
2 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacillus clausii infection | [1] | |||
Resistant Disease | Bacillus clausii infection [ICD-11: 1C4Y.1] | |||
Resistant Drug | Pristinamycin I | |||
Molecule Alteration | Methylation | Ribosomal methylation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Bacillus clausii ATCC 21536 | 79880 | ||
Experiment for Molecule Alteration |
Cloning experiments and gene seqencing assay | |||
Experiment for Drug Resistance |
Agar dilution assay | |||
Mechanism Description | This pattern of resistance generally due to the presence of an erm gene encoding a ribosomal methylase. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacillus clausii infection | [1] | |||
Resistant Disease | Bacillus clausii infection [ICD-11: 1C4Y.1] | |||
Resistant Drug | Pristinamycin IA | |||
Molecule Alteration | Methylation | Ribosomal methylation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Bacillus clausii ATCC 21536 | 79880 | ||
Experiment for Molecule Alteration |
Cloning experiments and gene seqencing assay | |||
Experiment for Drug Resistance |
Agar dilution assay | |||
Mechanism Description | This pattern of resistance generally due to the presence of an erm gene encoding a ribosomal methylase. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.