Molecule Information
General Information of the Molecule (ID: Mol01081)
Name |
Signal peptidase I (LEPB)
,Streptococcus pneumoniae
|
||||
---|---|---|---|---|---|
Synonyms |
SPase I; Leader peptidase I; spi; SP_0402
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
lepB
|
||||
Sequence |
MNSFKNFLKEWGLFLLILSLLALSRIFFWSNVRVEGHSMDPTLADGEILFVVKHLPIDRF
DIVVAHEEDGNKDIVKRVIGMPGDTIRYENDKLYINDKETDEPYLADYIKRFKDDKLQST YSGKGFEGNKGTFFRSIAQKAQAFTVDVNYNTNFSFTVPEGEYLLLGDDRLVSSDSRHVG TFKAKDITGEAKFRLWPITRIGTF Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Investigative Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Streptococcus pneumoniae infection | [1], [2] | |||
Resistant Disease | Streptococcus pneumoniae infection [ICD-11: AA80.2] | |||
Resistant Drug | Arylomycin C16 | |||
Molecule Alteration | Missense mutation | p.S29P |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Staphylococcus capitis isolates strain | 29388 | ||
Staphylococcus caprae isolates strain | 29380 | |||
Staphylococcus cohnii isolates strain | 29382 | |||
Staphylococcus epidermidis isolates strain | 1282 | |||
Staphylococcus haemolyticus isolates strain | 1283 | |||
Staphylococcus hominis isolates strain | 1290 | |||
Staphylococcus lugdunensis isolates strain | 28035 | |||
Experiment for Molecule Alteration |
Genome sequence assay | |||
Experiment for Drug Resistance |
Agar dilution method assay | |||
Mechanism Description | S. epidermidis evolves resistance to the arylomycins by mutating residue 29 of one of its two SPases, SpsIB, from Ser (Ser29) to Pro (Pro29). |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.