Molecule Information

General Information of the Molecule (ID: Mol01081)

Name	Signal peptidase I (LEPB) ,Streptococcus pneumoniae
Synonyms	SPase I; Leader peptidase I; spi; SP_0402 Click to Show/Hide
Molecule Type	Protein
Gene Name	lepB
Sequence	MNSFKNFLKEWGLFLLILSLLALSRIFFWSNVRVEGHSMDPTLADGEILFVVKHLPIDRF DIVVAHEEDGNKDIVKRVIGMPGDTIRYENDKLYINDKETDEPYLADYIKRFKDDKLQST YSGKGFEGNKGTFFRSIAQKAQAFTVDVNYNTNFSFTVPEGEYLLLGDDRLVSSDSRHVG TFKAKDITGEAKFRLWPITRIGTF Click to Show/Hide
Uniprot ID	LEP_STRPN
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Firmicutes Class: Bacilli Order: Lactobacillales Family: Streptococcaceae Genus: Streptococcus Species: Streptococcus pneumoniae

Type(s) of Resistant Mechanism of This Molecule

ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Investigative Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Arylomycin C16

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Streptococcus pneumoniae infection			[1], [2]
Resistant Disease	Streptococcus pneumoniae infection [ICD-11: AA80.2]		Disease Info
Resistant Drug	Arylomycin C16		Drug Info
Molecule Alteration	Missense mutation	p.S29P
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Staphylococcus capitis isolates strain		29388
	Staphylococcus caprae isolates strain		29380
	Staphylococcus cohnii isolates strain		29382
	Staphylococcus epidermidis isolates strain		1282
	Staphylococcus haemolyticus isolates strain		1283
	Staphylococcus hominis isolates strain		1290
	Staphylococcus lugdunensis isolates strain		28035
Experiment for Molecule Alteration	Genome sequence assay
Experiment for Drug Resistance	Agar dilution method assay
Mechanism Description	S. epidermidis evolves resistance to the arylomycins by mutating residue 29 of one of its two SPases, SpsIB, from Ser (Ser29) to Pro (Pro29).

References

Ref 1	Positive selection in penicillin-binding proteins 1a, 2b, and 2x from Streptococcus pneumoniae and its correlation with amoxicillin resistance development. Infect Genet Evol. 2008 May;8(3):331-9. doi: 10.1016/j.meegid.2008.02.001. Epub 2008 Feb 14.
Ref 2	In vitro activities of arylomycin natural-product antibiotics against Staphylococcus epidermidis and other coagulase-negative staphylococci. Antimicrob Agents Chemother. 2011 Mar;55(3):1130-4. doi: 10.1128/AAC.01459-10. Epub 2010 Dec 28.