General Information of the Molecule (ID: Mol01063)
Name
Quinolone resistance protein NorA (NORA) ,Staphylococcus aureus
Molecule Type
Protein
Gene Name
norA
Sequence
MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGT
LADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADIS
PSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDP
KKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDI
SIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISF
VVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIY
MAIGVSLAGVVIVLIEKQHRAKLKEQNM
    Click to Show/Hide
3D-structure
PDB ID
8TTE
Classification
Transport protein
Method
Electron microscopy
Resolution
3.26  Å
Function
Involved in quinolone resistance. May constitute a membrane-associated active efflux pump of hydrophilic quinolones.
    Click to Show/Hide
Uniprot ID
NORA_STAAU
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Bacillales
Family: Staphylococcaceae
Genus: Staphylococcus
Species: Staphylococcus aureus
Type(s) of Resistant Mechanism of This Molecule
  IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
4 drug(s) in total
Click to Show/Hide the Full List of Drugs
Ciprofloxacin XR
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] [1]
Resistant Disease Staphylococcus aureus infection [ICD-11: 1B54.0]
Resistant Drug Ciprofloxacin XR
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli HB101 634468
Staphylococcus aureus strain SA113 1280
Experiment for
Molecule Alteration
Dideoxy chain-termination method assay
Mechanism Description The norA gene cloned from chromosomal DNA of quinolone-resistant Staphylococcus aureus Tk2566 conferred relatively high resistance to hydrophilic quinolones such as norfloxacin, enoxacin, ofloxacin, and ciprofloxacin, but only low or no resistance at all to hydrophobic ones such as nalidixic acid, oxolinic acid, and sparfloxacin in S. aureus and Escherichia coli.
Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] [1]
Resistant Disease Staphylococcus aureus infection [ICD-11: 1B54.0]
Resistant Drug Ciprofloxacin XR
Molecule Alteration Expression
Acquired
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli HB101 634468
Staphylococcus aureus strain SA113 1280
Experiment for
Molecule Alteration
Dideoxy chain-termination method assay
Mechanism Description The norA gene cloned from chromosomal DNA of quinolone-resistant Staphylococcus aureus Tk2566 conferred relatively high resistance to hydrophilic quinolones such as norfloxacin, enoxacin, ofloxacin, and ciprofloxacin, but only low or no resistance at all to hydrophobic ones such as nalidixic acid, oxolinic acid, and sparfloxacin in S. aureus and Escherichia coli. S. aureus SA113 (pTUS20) harboring a plasmid carrying the staphylococcal norA gene was 16 to 64 times more resistant to relatively hydrophilic quinolones.
Disease Class: Escherichia coli infection [ICD-11: 1A03.0] [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
Resistant Drug Ciprofloxacin XR
Molecule Alteration Expression
Acquired
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli HB101 634468
Staphylococcus aureus strain SA113 1280
Experiment for
Molecule Alteration
Dideoxy chain-termination method assay
Mechanism Description The norA gene cloned from chromosomal DNA of quinolone-resistant Staphylococcus aureus Tk2566 conferred relatively high resistance to hydrophilic quinolones such as norfloxacin, enoxacin, ofloxacin, and ciprofloxacin, but only low or no resistance at all to hydrophobic ones such as nalidixic acid, oxolinic acid, and sparfloxacin in S. aureus and Escherichia coli. Escherichia coli strains containing one of the plasmids carrying the norA gene (pTUS1, pTUS180, pTUS829, and pTUS206) were 8 to 64 times more resistant to the hydrophilic quinolones than the parent quinolone-susceptible strain.
Enoxacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] [1]
Resistant Disease Staphylococcus aureus infection [ICD-11: 1B54.0]
Resistant Drug Enoxacin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli HB101 634468
Staphylococcus aureus strain SA113 1280
Experiment for
Molecule Alteration
Dideoxy chain-termination method assay
Mechanism Description The norA gene cloned from chromosomal DNA of quinolone-resistant Staphylococcus aureus Tk2566 conferred relatively high resistance to hydrophilic quinolones such as norfloxacin, enoxacin, ofloxacin, and ciprofloxacin, but only low or no resistance at all to hydrophobic ones such as nalidixic acid, oxolinic acid, and sparfloxacin in S. aureus and Escherichia coli.
Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] [1]
Resistant Disease Staphylococcus aureus infection [ICD-11: 1B54.0]
Resistant Drug Enoxacin
Molecule Alteration Expression
Acquired
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli HB101 634468
Staphylococcus aureus strain SA113 1280
Experiment for
Molecule Alteration
Dideoxy chain-termination method assay
Mechanism Description The norA gene cloned from chromosomal DNA of quinolone-resistant Staphylococcus aureus Tk2566 conferred relatively high resistance to hydrophilic quinolones such as norfloxacin, enoxacin, ofloxacin, and ciprofloxacin, but only low or no resistance at all to hydrophobic ones such as nalidixic acid, oxolinic acid, and sparfloxacin in S. aureus and Escherichia coli. S. aureus SA113 (pTUS20) harboring a plasmid carrying the staphylococcal norA gene was 16 to 64 times more resistant to relatively hydrophilic quinolones.
Disease Class: Escherichia coli infection [ICD-11: 1A03.0] [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
Resistant Drug Enoxacin
Molecule Alteration Expression
Acquired
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli HB101 634468
Staphylococcus aureus strain SA113 1280
Experiment for
Molecule Alteration
Dideoxy chain-termination method assay
Mechanism Description The norA gene cloned from chromosomal DNA of quinolone-resistant Staphylococcus aureus Tk2566 conferred relatively high resistance to hydrophilic quinolones such as norfloxacin, enoxacin, ofloxacin, and ciprofloxacin, but only low or no resistance at all to hydrophobic ones such as nalidixic acid, oxolinic acid, and sparfloxacin in S. aureus and Escherichia coli. Escherichia coli strains containing one of the plasmids carrying the norA gene (pTUS1, pTUS180, pTUS829, and pTUS206) were 8 to 64 times more resistant to the hydrophilic quinolones than the parent quinolone-susceptible strain.
Norfloxacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] [1]
Resistant Disease Staphylococcus aureus infection [ICD-11: 1B54.0]
Resistant Drug Norfloxacin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli HB101 634468
Staphylococcus aureus strain SA113 1280
Experiment for
Molecule Alteration
Dideoxy chain-termination method assay
Mechanism Description The norA gene cloned from chromosomal DNA of quinolone-resistant Staphylococcus aureus Tk2566 conferred relatively high resistance to hydrophilic quinolones such as norfloxacin, enoxacin, ofloxacin, and ciprofloxacin, but only low or no resistance at all to hydrophobic ones such as nalidixic acid, oxolinic acid, and sparfloxacin in S. aureus and Escherichia coli.
Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] [1]
Resistant Disease Staphylococcus aureus infection [ICD-11: 1B54.0]
Resistant Drug Norfloxacin
Molecule Alteration Expression
Acquired
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli HB101 634468
Staphylococcus aureus strain SA113 1280
Experiment for
Molecule Alteration
Dideoxy chain-termination method assay
Mechanism Description The norA gene cloned from chromosomal DNA of quinolone-resistant Staphylococcus aureus Tk2566 conferred relatively high resistance to hydrophilic quinolones such as norfloxacin, enoxacin, ofloxacin, and ciprofloxacin, but only low or no resistance at all to hydrophobic ones such as nalidixic acid, oxolinic acid, and sparfloxacin in S. aureus and Escherichia coli. S. aureus SA113 (pTUS20) harboring a plasmid carrying the staphylococcal norA gene was 16 to 64 times more resistant to relatively hydrophilic quinolones.
Disease Class: Escherichia coli infection [ICD-11: 1A03.0] [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
Resistant Drug Norfloxacin
Molecule Alteration Expression
Acquired
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli HB101 634468
Staphylococcus aureus strain SA113 1280
Experiment for
Molecule Alteration
Dideoxy chain-termination method assay
Mechanism Description The norA gene cloned from chromosomal DNA of quinolone-resistant Staphylococcus aureus Tk2566 conferred relatively high resistance to hydrophilic quinolones such as norfloxacin, enoxacin, ofloxacin, and ciprofloxacin, but only low or no resistance at all to hydrophobic ones such as nalidixic acid, oxolinic acid, and sparfloxacin in S. aureus and Escherichia coli. Escherichia coli strains containing one of the plasmids carrying the norA gene (pTUS1, pTUS180, pTUS829, and pTUS206) were 8 to 64 times more resistant to the hydrophilic quinolones than the parent quinolone-susceptible strain.
Ofloxacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] [1]
Resistant Disease Staphylococcus aureus infection [ICD-11: 1B54.0]
Resistant Drug Ofloxacin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli HB101 634468
Staphylococcus aureus strain SA113 1280
Experiment for
Molecule Alteration
Dideoxy chain-termination method assay
Mechanism Description The norA gene cloned from chromosomal DNA of quinolone-resistant Staphylococcus aureus Tk2566 conferred relatively high resistance to hydrophilic quinolones such as norfloxacin, enoxacin, ofloxacin, and ciprofloxacin, but only low or no resistance at all to hydrophobic ones such as nalidixic acid, oxolinic acid, and sparfloxacin in S. aureus and Escherichia coli.
Disease Class: Staphylococcus aureus infection [ICD-11: 1B54.0] [1]
Resistant Disease Staphylococcus aureus infection [ICD-11: 1B54.0]
Resistant Drug Ofloxacin
Molecule Alteration Expression
Acquired
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli HB101 634468
Staphylococcus aureus strain SA113 1280
Experiment for
Molecule Alteration
Dideoxy chain-termination method assay
Mechanism Description The norA gene cloned from chromosomal DNA of quinolone-resistant Staphylococcus aureus Tk2566 conferred relatively high resistance to hydrophilic quinolones such as norfloxacin, enoxacin, ofloxacin, and ciprofloxacin, but only low or no resistance at all to hydrophobic ones such as nalidixic acid, oxolinic acid, and sparfloxacin in S. aureus and Escherichia coli. S. aureus SA113 (pTUS20) harboring a plasmid carrying the staphylococcal norA gene was 16 to 64 times more resistant to relatively hydrophilic quinolones.
Disease Class: Escherichia coli infection [ICD-11: 1A03.0] [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
Resistant Drug Ofloxacin
Molecule Alteration Expression
Acquired
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli HB101 634468
Staphylococcus aureus strain SA113 1280
Experiment for
Molecule Alteration
Dideoxy chain-termination method assay
Mechanism Description The norA gene cloned from chromosomal DNA of quinolone-resistant Staphylococcus aureus Tk2566 conferred relatively high resistance to hydrophilic quinolones such as norfloxacin, enoxacin, ofloxacin, and ciprofloxacin, but only low or no resistance at all to hydrophobic ones such as nalidixic acid, oxolinic acid, and sparfloxacin in S. aureus and Escherichia coli. Escherichia coli strains containing one of the plasmids carrying the norA gene (pTUS1, pTUS180, pTUS829, and pTUS206) were 8 to 64 times more resistant to the hydrophilic quinolones than the parent quinolone-susceptible strain.
References
Ref 1 Nucleotide sequence and characterization of the Staphylococcus aureus norA gene, which confers resistance to quinolones. J Bacteriol. 1990 Dec;172(12):6942-9. doi: 10.1128/jb.172.12.6942-6949.1990.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.