General Information of the Molecule (ID: Mol01059)
Name
Putative chloroquine resistance transporter (PVCRT) ,Plasmodium vivax
Synonyms
Probable transporter cg10; pvcg10; pfcrt ortholog; pvcrt-o; CRT-O; PVX_087980
    Click to Show/Hide
Molecule Type
Protein
Gene Name
CG10
Gene ID
5472721
Sequence
MTILKKKKKGSPQITPDERYRELDSHAQNESEIQEDVPISRKIANFLKLAYNEIRENISI
YLLIIVYLCVCVMNKLLAKRTLKKIGNYSFVTSETHNCICMVVFFALYFMFGRRVMSAKE
RHRNFGVQFLLISLLDACSVIIAFIGLTRTTGNIQSFVMQLSIPINMFFCFLILRYRYHL
FNYVGAFIIVVTIAVVEFMLSFETQEENSIVFNLVLIASLIPLSFSNMTREIVFKKYKIN
ILRLNAVVSFFQIFTSCLMLPMYTLPFLKQINLPFSEIGTNIKNGFRCLFLGQNTIVENC
GLGMSKMCDDCEGAWKTFIAYSFFNICDNLITSFIIEKFSTMTYTIVSCIQGPAIAIAYY
FKFLAGDAVMQPRMLDFVTLFGYLFGSIIYRIGNIILEKKRMMEAGNDDDSEGELTNADS
IITH
    Click to Show/Hide
Function
May regulate endogenous transporter.
    Click to Show/Hide
Uniprot ID
CRT_PLAVS
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Apicomplexa
Class: Aconoidasida
Order: Haemosporida
Family: Plasmodiidae
Genus: Plasmodium
Species: Plasmodium vivax
Type(s) of Resistant Mechanism of This Molecule
  IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Chloroquine
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Malaria [1]
Resistant Disease Malaria [ICD-11: 1F45.0]
Resistant Drug Chloroquine
Molecule Alteration Missense mutation
p.K10 insertion (c.AAG)
Experimental Note Discovered Using In-vivo Testing Model
Mechanism Description Mutations in k10 insertion in the Pvcrt-o gene have been identified as a possible molecular marker of CQ resistance in P.vivax.
Disease Class: Malaria [1]
Resistant Disease Malaria [ICD-11: 1F45.0]
Resistant Drug Chloroquine
Molecule Alteration Missense mutation
p.K10 insertion (c.AAG)
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Plasmodium vivax isolates 5855
Experiment for
Molecule Alteration
Nested PCR
Mechanism Description Mutations in k10 insertion in the Pvcrt-o gene have been identified as a possible molecular marker of CQ resistance in P.vivax.
Disease Class: Malaria [2]
Resistant Disease Malaria [ICD-11: 1F45.0]
Resistant Drug Chloroquine
Molecule Alteration Missense mutation
p.S249P
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Yeast CH1305 4932
Experiment for
Molecule Alteration
Western blotting analysis
Experiment for
Drug Resistance
Quantitative Growth Rate assay
Mechanism Description It is surprising then that the data presented here suggests a single mutation (S249P in PvCRT isoform CQR3) can increase CQ transport by 32% relative to wild type.
Disease Class: Malaria [3]
Resistant Disease Malaria [ICD-11: 1F45.0]
Resistant Drug Chloroquine
Molecule Alteration Expression
Up-regulation
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Plasmodium vivax strains 5855
Mechanism Description Patients with CQ-resistant P. vivax parasites presented a higher gene expression of pvcrt-o and pvmdr-1 at D0 and DR when compared to the susceptible group. For the CQR patients, median gene expression values at D0 and DR, presented 2.4 fold (95% CI: 0.96-7.1) and 6.1 fold (95% CI: 3.8-14.3) increase in pvcrt-o levels compared to the susceptible patients at D0 with 0.12 fold (95% CI: 0.034-0.324). Median gene expression for pvmdr-1 presented 2.0 fold (95% CI: 0.95-3.8) and 2.4 fold (95% CI: 0.53-9.1) increase levels at D0 and DR, for the CQR patients versus 0.288 fold (95% CI: 0.068-0.497) for the susceptible patients.
Piperaquine
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Malaria [4]
Resistant Disease Malaria [ICD-11: 1F45.0]
Resistant Drug Piperaquine
Molecule Alteration Missense mutation
p.C350R
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Yeast strain CH1305 4932
Experiment for
Molecule Alteration
Western blotting analysis
Mechanism Description At 300 uM PPQ, C350R/7G8 PfCRT shows a 3.9-fold increased rate of PPQ transport relative to that of 7G8 PfCRT, and F145I/Dd2 PfCRT shows a 2.7-fold increased rate of PPQ transport relative to that of Dd2.
References
Ref 1 Distribution of Mutations Associated with Antifolate and Chloroquine Resistance among Imported Plasmodium vivax in the State of Qatar. Am J Trop Med Hyg. 2017 Dec;97(6):1797-1803. doi: 10.4269/ajtmh.17-0436. Epub 2017 Sep 28.
Ref 2 Analysis of Plasmodium vivax Chloroquine Resistance Transporter Mutant Isoforms. Biochemistry. 2017 Oct 17;56(41):5615-5622. doi: 10.1021/acs.biochem.7b00749. Epub 2017 Sep 26.
Ref 3 Expression levels of pvcrt-o and pvmdr-1 are associated with chloroquine resistance and severe Plasmodium vivax malaria in patients of the Brazilian Amazon. PLoS One. 2014 Aug 26;9(8):e105922. doi: 10.1371/journal.pone.0105922. eCollection 2014.
Ref 4 Altered Drug Transport by Plasmodium falciparum Chloroquine Resistance Transporter Isoforms Harboring Mutations Associated with Piperaquine Resistance. Biochemistry. 2020 Jul 14;59(27):2484-2493. doi: 10.1021/acs.biochem.0c00247. Epub 2020 Jul 1.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.