Molecule Information

General Information of the Molecule (ID: Mol01046)

• Name: Phospholipid-translocating ATPase (RTA2) ,Candida albicans
• Synonyms: RTA2; orf19.24; CAALFM_C206470WA; Phospholipid-translocating ATPase
• Molecule Type: Protein
• Gene Name: RTA2
• Gene ID: 3646567
• Sequence:
  MSEILNYLSSWTPTSTPTSTTLSSIATSHVSKLSQTVASVISQATTETDWYNLRSLSQAY
  RGAQASLTIISAEKVLATATDSQVQSRATQAIFEATLNLKDLSMEQNIYGYELNRAANII
  YLVVYAIIFGYTLLMCIKSKYWWYNVTFVCGYGLEFVGFLGRVLSFNDTSNMSHYIMQSV
  ALTIAPAFIMAGVYFLFGQLVVIHGRQYSVLKPMWYSYFFITADVVSLLIQAAGGGIASV
  ASSNHKDSSVGTNIMIAGIAAQVVAMTIFLVFWFEFLNRLYFKNSRSDLIVDCPYGRRSI
  SNYFKLLLNVKSVRGHRHTHLEKYYNEKFASIRQIPLFDYMVLAMTIAVIVVYIRCVYRV
  AELAEGWGGYLFTHEPYLMILDAAMIAIAGLIFIPFHPVWVFGKNNIVKLATIKKNLDEN
  EKNQDVEYNDDVESQERSSSVVANDIHCLNSKL
• Uniprot ID: Q59Q40_CANAL

Kingdom: Fungi
Phylum: Ascomycota
Class: Saccharomycetes
Order: Saccharomycetales
Family: Debaryomycetaceae
Genus: Candida
Species: Candida albicans

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Fluconazole

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Candida albicans infection [1]

• Sensitive Disease: Candida albicans infection [ICD-11: 1F23.Y]
• Sensitive Drug: Fluconazole
• Molecule Alteration: Missense mutation; p.G234S
• Experimental Note: Identified from the Human Clinical Data
• Cell Pathway Regulation: Calcineurin signaling pathway; Regulation; hsa04310
• In Vitro Model: Candida albicans strain; 5476
• In Vivo Model: Systemic mice candidiasis model; Mus musculus
• Experiment for Molecule Alteration: DNA sequencing assay
• Experiment for Drug Resistance: Broth microdilution method assay
• Mechanism Description: Furthermore, we confirmed that G234S mutant enhanced the therapeutic efficacy of fluconazole against systemic candidiasis and significantly increased the accumulation of dihydrosphingosine by decreasing its release.

References

• Ref 1: Mutation of G234 amino acid residue in candida albicans drug-resistance-related protein Rta2p is associated with fluconazole resistance and dihydrosphingosine transport. Virulence. 2015;6(6):599-607. doi: 10.1080/21505594.2015.1051296.