General Information of the Molecule (ID: Mol01018)
Name
Multidrug transporter MdfA (MDFA) ,Escherichia coli
Synonyms
Chloramphenicol resistance pump Cmr; cmlA; cmr; b0842; JW0826
    Click to Show/Hide
Molecule Type
Protein
Gene Name
mdfA
Gene ID
945448
Sequence
MQNKLASGARLGRQALLFPLCLVLYEFSTYIGNDMIQPGMLAVVEQYQAGIDWVPTSMTA
YLAGGMFLQWLLGPLSDRIGRRPVMLAGVVWFIVTCLAILLAQNIEQFTLLRFLQGISLC
FIGAVGYAAIQESFEEAVCIKITALMANVALIAPLLGPLVGAAWIHVLPWEGMFVLFAAL
AAISFFGLQRAMPETATRIGEKLSLKELGRDYKLVLKNGRFVAGALALGFVSLPLLAWIA
QSPIIIITGEQLSSYEYGLLQVPIFGALIAGNLLLARLTSRRTVRSLIIMGGWPIMIGLL
VAAAATVISSHAYLWMTAGLSIYAFGIGLANAGLVRLTLFASDMSKGTVSAAMGMLQMLI
FTVGIEISKHAWLNGGNGLFNLFNLVNGILWLSLMVIFLKDKQMGNSHEG
    Click to Show/Hide
Function
Efflux pump driven by the proton motive force. Confers resistance to a broad spectrum of chemically unrelated drugs. Confers resistance to a diverse group of cationic or zwitterionic lipophilic compounds such as ethidium bromide, tetraphenylphosphonium, rhodamine, daunomycin, benzalkonium, rifampicin, tetracycline, puromycin, and to chemically unrelated, clinically important antibiotics such as chloramphenicol, erythromycin, and certain aminoglycosides and fluoroquinolones. Overexpression results in isopropyl-beta-D-thiogalactopyranoside (IPTG) exclusion and spectinomycin sensitivity. Transport of neutral substrates is electrogenic, whereas transport of cationic substrates is electroneutral. In addition to its role in multidrug resistance, confers extreme alkaline pH resistance, allowing the growth under conditions that are close to those used normally by alkaliphiles. This activity requires Na(+) or K(+).
    Click to Show/Hide
Uniprot ID
MDFA_ECOLI
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Escherichia
Species: Escherichia coli
Type(s) of Resistant Mechanism of This Molecule
  IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
4 drug(s) in total
Click to Show/Hide the Full List of Drugs
Chloramphenicol
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacterial infection [1], [2]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
Resistant Drug Chloramphenicol
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli BL21(DE3) 469008
Escherichia coli C43 (DE3) 562
Mechanism Description Being one of the best-characterized bacterial MFS antiporters biochemically, MdfA from Escherichia coli (ecMdfA) is known to confer resistance to a variety of structurally distinct cationic and zwitterionic lipophilic compounds, as well as to a number of electroneutral antibiotics of clinical importance.
Disease Class: Salmonella enterica infection [3]
Resistant Disease Salmonella enterica infection [ICD-11: 1A09.0]
Resistant Drug Chloramphenicol
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Salmonella enterica serovar Typhimurium ATCC 14028s 588858
Experiment for
Molecule Alteration
Quantitative real-time PCR
Experiment for
Drug Resistance
L agar plate method assay
Mechanism Description Overexpression or overproduction of mdfA confers drug resistance.
Doxorubicin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Salmonella enterica infection [3]
Resistant Disease Salmonella enterica infection [ICD-11: 1A09.0]
Resistant Drug Doxorubicin
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Salmonella enterica serovar Typhimurium ATCC 14028s 588858
Experiment for
Molecule Alteration
Quantitative real-time PCR
Experiment for
Drug Resistance
L agar plate method assay
Mechanism Description Overexpression or overproduction of mdfA confers drug resistance.
Norfloxacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Salmonella enterica infection [3]
Resistant Disease Salmonella enterica infection [ICD-11: 1A09.0]
Resistant Drug Norfloxacin
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Salmonella enterica serovar Typhimurium ATCC 14028s 588858
Experiment for
Molecule Alteration
Quantitative real-time PCR
Experiment for
Drug Resistance
L agar plate method assay
Mechanism Description Overexpression or overproduction of mdfA confers drug resistance.
Tetracycline
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Salmonella enterica infection [3]
Resistant Disease Salmonella enterica infection [ICD-11: 1A09.0]
Resistant Drug Tetracycline
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Salmonella enterica serovar Typhimurium ATCC 14028s 588858
Experiment for
Molecule Alteration
Quantitative real-time PCR
Experiment for
Drug Resistance
L agar plate method assay
Mechanism Description Overexpression or overproduction of mdfA confers drug resistance.
References
Ref 1 Substrate-bound structure of the E. coli multidrug resistance transporter MdfA. Cell Res. 2015 Sep;25(9):1060-73. doi: 10.1038/cr.2015.94. Epub 2015 Aug 4.
Ref 2 The Escherichia coli cmlA gene encodes the multidrug efflux pump Cmr/MdfA and is responsible for isopropyl-beta-D-thiogalactopyranoside exclusion and spectinomycin sensitivity. J Bacteriol. 1998 Nov;180(22):6072-5. doi: 10.1128/JB.180.22.6072-6075.1998.
Ref 3 Virulence and drug resistance roles of multidrug efflux systems of Salmonella enterica serovar Typhimurium. Mol Microbiol. 2006 Jan;59(1):126-41. doi: 10.1111/j.1365-2958.2005.04940.x.
insuranceusa.com
visits since 2022

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.