General Information of the Molecule (ID: Mol01017)
Name
Multidrug resistance protein PmpM (PMPM) ,Pseudomonas aeruginosa
Synonyms
H(+)/drug antiporter; Multidrug-efflux transporter; norM; PA1361
    Click to Show/Hide
Molecule Type
Protein
Gene Name
pmpM
Gene ID
880959
Sequence
MNSPALPLSRGLRIRAELKELLTLAAPIMIAQLATTAMGFVDAVMAGRASPHDLAAVALG
NSIWIPMFLLMTGTLLATTAKVAQRHGAGDQPGTGPLVRQALWLALLIGPLSGAVLWWLS
EPILGLMKVRPELIGPSLLYLKGIALGFPAAALYHVLRCYTNGLGRTRPSMVLGIGGLLL
NIPINYALIYGHFGMPKMGGPGCGWATGSVMWFMFLGMLFWVNKASIYRASQLFSRWEWP
DRATIGPLVAVGLPIGIAVFAESSIFSVIALLIGGLDENVVAGHQIALNFSALVFMIPYS
LGMAVTVRVGHNLGAGLPRDARFAAGVGMAAALGYACVSASLMLLLREQIAAMYSPDPAV
IAIAASLIVFSALFQFSDALQVTAAGALRGYQDTRVTMIMTLFAYWGIGLPVGYSLGLTD
WFQEPTGPRGLWQGLVVGLTGAAIMLCIRLARSARRFIRQHERLQREDAEAASVLGR
    Click to Show/Hide
Function
Multidrug efflux pump that functions as an H(+)/drug antiporter. Confers resistance to benzalkonium chloride, fluoroquinolones, ethidium bromide, acriflavine and tetraphenylphosphonium chloride.
    Click to Show/Hide
Uniprot ID
PMPM_PSEAE
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Pseudomonadales
Family: Pseudomonadaceae
Genus: Pseudomonas
Species: Pseudomonas aeruginosa
Type(s) of Resistant Mechanism of This Molecule
  IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
Click to Show/Hide the Full List of Drugs
Acriflavine
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] [1]
Resistant Disease Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z]
Resistant Drug Acriflavine
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32/pSTV28 562
Experiment for
Molecule Alteration
PCR amplification and DNA sequence assay
Experiment for
Drug Resistance
MIC assay
Mechanism Description PmpM is a multi drug efflux pump coupled with hydrogen ions, which reduces the intracellular drug concentration and produces drug resistance.
Benzalkonium chloride
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] [1]
Resistant Disease Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z]
Resistant Drug Benzalkonium chloride
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32/pSTV28 562
Experiment for
Molecule Alteration
PCR amplification and DNA sequence assay
Experiment for
Drug Resistance
MIC assay
Mechanism Description PmpM is a multi drug efflux pump coupled with hydrogen ions, which reduces the intracellular drug concentration and produces drug resistance.
Fluoroquinolones
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] [1]
Resistant Disease Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z]
Resistant Drug Fluoroquinolones
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32/pSTV28 562
Experiment for
Molecule Alteration
PCR amplification and DNA sequence assay
Experiment for
Drug Resistance
MIC assay
Mechanism Description PmpM is a multi drug efflux pump coupled with hydrogen ions, which reduces the intracellular drug concentration and produces drug resistance.
Investigative Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Homidium bromide
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] [1]
Resistant Disease Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z]
Resistant Drug Homidium bromide
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32/pSTV28 562
Experiment for
Molecule Alteration
PCR amplification and DNA sequence assay
Experiment for
Drug Resistance
MIC assay
Mechanism Description PmpM is a multi drug efflux pump coupled with hydrogen ions, which reduces the intracellular drug concentration and produces drug resistance.
Tetraphenylphosphonium chloride
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z] [1]
Resistant Disease Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z]
Resistant Drug Tetraphenylphosphonium chloride
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli kAM32/pSTV28 562
Experiment for
Molecule Alteration
PCR amplification and DNA sequence assay
Experiment for
Drug Resistance
MIC assay
Mechanism Description PmpM is a multi drug efflux pump coupled with hydrogen ions, which reduces the intracellular drug concentration and produces drug resistance.
References
Ref 1 An H(+)-coupled multidrug efflux pump, PmpM, a member of the MATE family of transporters, from Pseudomonas aeruginosa. J Bacteriol. 2004 Jan;186(1):262-5. doi: 10.1128/JB.186.1.262-265.2004.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.