Molecule Information
General Information of the Molecule (ID: Mol01016)
| Name |
Multidrug resistance protein MdtK (MDTK)
,Salmonella enterica serovar Typhimurium
|
||||
|---|---|---|---|---|---|
| Synonyms |
Multidrug-efflux transporter; norM; STM1425
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
mdtK
|
||||
| Gene ID | |||||
| Sequence |
MQKYTSEARQLLALRIPVILAQVAQTAMGFVDTVMAGGYSATDMAAVAIGTSIWLPAILF
GHGLLLALTPVIAQLNGSGRRERIAHQVRQGFWLAGFVSVLVMIVLWNAGYIIRSMHNID PALADKAVGYLRALLWGAPGYLFFQVARNQCEGLAKTKPGMVMGFLGLLVNIPVNYIFIY GHFGMPELGGIGCGVATAAVYWVMFIAMLSYIKHARSMRDIRNEKGFGKPDSVVMKRLIQ LGLPIALALFFEVTLFAVVALLVSPLGIVDVAGHQIALNFSSLMFVLPMSLAAAVTIRVG YRLGQGSTLDAQTAARTGLGVGICMAVVTAIFTVTLRKHIALLYNDNPEVVALAAQLMLL AAVYQISDSIQVIGSGILRGYKDTRSIFFITFTAYWVLGLPSGYILALTDLVVDRMGPAG FWMGFIIGLTSAAVLMMLRMRYLQRQPSAIILQRAAR Click to Show/Hide
|
||||
| Function |
Multidrug efflux pump that functions probably as a Na(+)/drug antiporter.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Salmonella enterica infection [ICD-11: 1A09.0] | [1] | |||
| Resistant Disease | Salmonella enterica infection [ICD-11: 1A09.0] | |||
| Resistant Drug | Acriflavine | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Salmonella enterica serovar Typhimurium ATCC 14028s | 588858 | ||
| Experiment for Molecule Alteration |
Quantitative real-time PCR | |||
| Experiment for Drug Resistance |
L agar plate method assay | |||
| Mechanism Description | Overexpression or overproduction of mdtk confers drug resistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Salmonella enterica infection [ICD-11: 1A09.0] | [1] | |||
| Resistant Disease | Salmonella enterica infection [ICD-11: 1A09.0] | |||
| Resistant Drug | Doxorubicin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Salmonella enterica serovar Typhimurium ATCC 14028s | 588858 | ||
| Experiment for Molecule Alteration |
Quantitative real-time PCR | |||
| Experiment for Drug Resistance |
L agar plate method assay | |||
| Mechanism Description | Overexpression or overproduction of mdtk confers drug resistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Salmonella enterica infection [ICD-11: 1A09.0] | [1] | |||
| Resistant Disease | Salmonella enterica infection [ICD-11: 1A09.0] | |||
| Resistant Drug | Norfloxacin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Salmonella enterica serovar Typhimurium ATCC 14028s | 588858 | ||
| Experiment for Molecule Alteration |
Quantitative real-time PCR | |||
| Experiment for Drug Resistance |
L agar plate method assay | |||
| Mechanism Description | Overexpression or overproduction of mdtk confers drug resistance. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
