General Information of the Molecule (ID: Mol01013)
Name
Multidrug resistance protein 1 (ABCB1) ,Plasmodium vivax
Synonyms
MDR1; Multidrug resistant protein 1; Fragment
    Click to Show/Hide
Molecule Type
Protein
Gene Name
MDR1
Sequence
DEVEKELNKKGTFELYKKIKTQKIPFFLPFKCLPSSHRKLLGVSFVCATISGGTLPFFVS
VFGVIMKNMNLGENVNDIIFSLVLIGIFQFILSFISSFCMDVVTTKILKTLKIEFLKSVF
YQDGQFHDNNPGSKLTSDLDFYLEQVNAGIGTKFITIFTYASAFLGLYIWSLFKNARLTL
CITCVFPLIYICGVICNKKVKINKKTSLLYNNNTMSIIEEALVGIRTVVSYCGENTILKK
FNLSEKLYSKYTLKANLMESLHIGMINGFILASYAFGFWYGTRIIISDLSNQQPNNDFHG
GSVISILLGVLISMFMLTIILPNITEYMKSLEATNNLYEIINRKPLVENNQDGKKLKDIK
KIQFKNVRFHYDTRKDVEIYKDLNFTLTEGKTYAFVGESGCGKSTILKLIERLYDPTEGD
VIINDSHNLKDVNLKWWRSKIGVVSQDPLLFSNSIKNNIKYSLYSLKDLEALSEESNEDG
FSSQSDSNSRNSCRAKCAGDLNDMIQTTDSTELIQVRKNYETIEDSEVVSVSKKVLIHDF
VSALPDKYETLVGSNASKLSGGQKQRISIARAIIRNPKILILDEATSSLDNKSEYLVQKT
INNLKGNENRITIIIAHRLSTIRYANTIFVLSNRENGSTVDVDVLGEDPTKDSNEKNEKH
DKQEKGGKNSSANQKIGNAGSYIIEQGTHDALMKNKNGIYYTMINNQKVSSKSSSNNDND
KDSDMKSSIYKDSERGYDPDEANGNAKNESASAKKSEKMSDAKASNTNAGGRLAFLRNLF
KRKPKAPNNLRVVYREIFSYKKDIAIIALSIMVAGGLYPLFALFYAKYVGTLFDFANLEA
NSNKYSLYILVIAIAMFISETLKNYYNNVIGEKVEKTMKLRLFENILYQEISFFDQDSHA
PGLLSAHINRDVHLLKTGLVNNIVIFTHFIVLFLVSMVMSFYFCPIVAAVLTGTYFIFMR
VFAIRARIAANKDVEKKRVNQPGTAFVYNSDDEIFKDPSFLIQEAFYNMNTVIIYGLEDY
FCTLIEKAIDYSNKGQKRKTLINSMLWGFSQSAQLFINSFAYWFGSFLIRRGTIQVDDFM
KSLFTFLFTGSYAGKLMSLKGDSENAKLSFERYYPLITRKSLIDVRDNGGIKIKNSNDIK
GKIEIMDVNFRYLSRPNVPIYKDLTFSCESKKTTAIVGETGSGKSTVMSLLMRFYDLKND
HHIVFKNEQTGESSKEQMQQGDEEQNVGMKNANEFSSSKEGADGQSSTLFKNSGKILLDG
VDICDYNLKDLRNLFSIVSQEPMLFNMSIYENIKFGKENATREDVKRACKFAAIDEFIES
LPNQYDTNVGPYGKSLSGGQKQRIAIARALLREPKILLLDEATSSLDSNSEKLIEKTIVD
IKDKADKTIITIAHRIASIKRSDKIVVFNNPDRTGSFVQAQ
    Click to Show/Hide
Uniprot ID
A0A1V0PL80_PLAVI
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Apicomplexa
Class: Aconoidasida
Order: Haemosporida
Family: Plasmodiidae
Genus: Plasmodium
Species: Plasmodium vivax
Type(s) of Resistant Mechanism of This Molecule
  IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Chloroquine
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Malaria [ICD-11: 1F45.0] [2]
Resistant Disease Malaria [ICD-11: 1F45.0]
Resistant Drug Chloroquine
Molecule Alteration Expression
Up-regulation
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Plasmodium vivax strains 5855
Mechanism Description Patients with CQ-resistant P. vivax parasites presented a higher gene expression of pvcrt-o and pvmdr-1 at D0 and DR when compared to the susceptible group. For the CQR patients, median gene expression values at D0 and DR, presented 2.4 fold (95% CI: 0.96-7.1) and 6.1 fold (95% CI: 3.8-14.3) increase in pvcrt-o levels compared to the susceptible patients at D0 with 0.12 fold (95% CI: 0.034-0.324). Median gene expression for pvmdr-1 presented 2.0 fold (95% CI: 0.95-3.8) and 2.4 fold (95% CI: 0.53-9.1) increase levels at D0 and DR, for the CQR patients versus 0.288 fold (95% CI: 0.068-0.497) for the susceptible patients.
Disease Class: Malaria [ICD-11: 1F45.0] [3]
Resistant Disease Malaria [ICD-11: 1F45.0]
Resistant Drug Chloroquine
Molecule Alteration Missense mutation
p.976F
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Plasmodium vivax isolates 5855
Mechanism Description In Southeast Asia the pvmdr1 976 F allele has been associated with reduced susceptibility to CQ. Finding the pvmdr1 976 F allele in 7/41 (17%) P. vivax might thus indicate a degree of CQ tolerance but probably not resistance in Honduras.
Quinine
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Malaria [ICD-11: 1F45.0] [4]
Resistant Disease Malaria [ICD-11: 1F45.0]
Resistant Drug Quinine
Molecule Alteration Missense mutation
p.M908L
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Plasmodium vivax isolates 5855
Experiment for
Molecule Alteration
In vitro drug assay
Experiment for
Drug Resistance
Analysis of genetic polymorphisms assay
Mechanism Description The pvmdr1 M908L substitutions in pvmdr1 in our samples was associated with reduced sensitivity to chloroquine, mefloquine, pyronaridine, piperaquine, quinine, artesunate and dihydroartem.
Clinical Trial Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Tanespimycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: bcr-abl1/leukemia [ICD-11: 2A61] [1]
Resistant Disease bcr-abl1/leukemia [ICD-11: 2A61]
Resistant Drug Tanespimycin
Molecule Alteration Expression
Up-regulation
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model K562 cells Blood Homo sapiens (Human) CVCL_0004
Experiment for
Drug Resistance
Colony forming unit assay
Mechanism Description Chronic long-term exposure to the clinically advanced HSP90i PU-H71 (Zelavespib) led to copy number gain and mutation (p.S164F) of the HSP90AA1 gene, and HSP90 overexpression. In contrast, acquired resistance toward other tested HSP90i (Tanespimycin and Coumermycin A1) was attained by MDR1 efflux pump overexpression. Remarkably, combined CDK7 and HSP90 inhibition display synergistic activity against therapy-resistant BCR-ABL1+ patient leukemia cells via blocking pro-survival HSR and HSP90 overexpression, providing a novel strategy to avoid the emergence of resistance against treatment with HSP90i alone.
BI-847325
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Thyroid gland cancer [ICD-11: 2D10.0] [5]
Sensitive Disease Thyroid gland cancer [ICD-11: 2D10.0]
Sensitive Drug BI-847325
Molecule Alteration Expression
Down-regulation
Experimental Note Revealed Based on the Cell Line Data
In Vitro Model C643 cells Thyroid gland Homo sapiens (Human) CVCL_5969
Experiment for
Molecule Alteration
qRT-PCR
Experiment for
Drug Resistance
Apoptosis assay
Mechanism Description Suppression of MAPK signaling pathway activity by BI-847325 treatment could significantly decrease the expression of?MDR1?and?MRP1?genes in C643 and SW1736 ATC cell lines. BI-847325 decreased multidrug resistance through downregulation of MDR1 and MRP1.
Investigative Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Dihydroartemisinin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Malaria [ICD-11: 1F45.0] [4]
Resistant Disease Malaria [ICD-11: 1F45.0]
Resistant Drug Dihydroartemisinin
Molecule Alteration Missense mutation
p.M908L
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Plasmodium vivax isolates 5855
Experiment for
Drug Resistance
In vitro drug assay
Mechanism Description Studies of genetic polymorphisms in two candidate genes of drug resistance (pvmdr1 and pvcrt-o) of the P. vivax isolates from this area and found association between the M908L substitution in pvmdr1 with reduced sensitivities to and chloroquine, mefloquine, pyronaridine, piperaquine, quinine, artesunate and dihydroartem.
References
Ref 1 Co-targeting HSP90 alpha and CDK7 overcomes resistance against HSP90 inhibitors in BCR-ABL1+ leukemia cells. Cell Death Dis. 2023 Dec 6;14(12):799.
Ref 2 Expression levels of pvcrt-o and pvmdr-1 are associated with chloroquine resistance and severe Plasmodium vivax malaria in patients of the Brazilian Amazon. PLoS One. 2014 Aug 26;9(8):e105922. doi: 10.1371/journal.pone.0105922. eCollection 2014.
Ref 3 Drug resistance associated genetic polymorphisms in Plasmodium falciparum and Plasmodium vivax collected in Honduras, Central America. Malar J. 2011 Dec 19;10:376. doi: 10.1186/1475-2875-10-376.
Ref 4 Ex vivo susceptibilities of Plasmodium vivax isolates from the China-Myanmar border to antimalarial drugs and association with polymorphisms in Pvmdr1 and Pvcrt-o genes. PLoS Negl Trop Dis. 2020 Jun 12;14(6):e0008255. doi: 10.1371/journal.pntd.0008255. eCollection 2020 Jun.
Ref 5 BI-847325, a selective dual MEK and Aurora kinases inhibitor, reduces aggressive behavior of anaplastic thyroid carcinoma on an in vitro three-dimensional culture. Cancer Cell Int. 2022 Dec 8;22(1):388.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.