Molecule Information
General Information of the Molecule (ID: Mol00984)
| Name |
Lanosterol 14-alpha demethylase (ERG11)
,Candida tropicalis
|
||||
|---|---|---|---|---|---|
| Synonyms |
CYPLI; Cytochrome P450 51; Cytochrome P450-14DM; Cytochrome P450-LIA1; Sterol 14-alpha demethylase; CYP51
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
ERG11
|
||||
| Sequence |
MAIVDTAIDGINYFLSLSLTQQITILVVFPFIYNIAWQLLYSLRKDRVPMVFYWIPWFGS
AASYGMQPYEFFEKCRLKYGDVFSFMLLGKVMTVYLGPKGHEFIYNAKLSDVSAEEAYTH LTTPVFGKGVIYDCPNSRLMEQKKFAKFALTTDSFKTYVPKIREEVLNYFVNDVSFKTKE RDHGVASVMKTQPEITIFTASRCLFGDEMRKSFDRSFAQLYADLDKGFTPINFVFPNLPL PHYWRRDAAQRKISAHYMKEIKRRRESGDIDPKRDLIDSLLVNSTYKDGVKMTDQEIANL LIGVLMGGQHTSASTSAWFLLHLAEQPQLQDDLYEELTNLLKEKGGDLNDLTYEDLQKLP LVNNTIKETLRMHMPLHSIFRKVMNPLRVPNTKYVIPKGHYVLVSAGYAHTSDRWFEHPE HFNPRRWESDDTKASAVSFNSEDTVDYGFGKISKGVSSPYLPFGGGRHRCIGEQFAYVQL GTILTTYIYNFKWRLNGDKVPDVDYQSMVTLPLEPAEIVWEKRDTCMV Click to Show/Hide
|
||||
| Function |
Catalyzes C14-demethylation of lanosterol which is critical for ergosterol biosynthesis. It transforms lanosterol into 4,4'-dimethyl cholesta-8,14,24-triene-3-beta-ol.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Candida krusei infection | [1] | |||
| Resistant Disease | Candida krusei infection [ICD-11: 1F23.4] | |||
| Resistant Drug | Fluconazole | |||
| Molecule Alteration | Missense mutation | p.Y132F |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Candida tropicalis strain | 5482 | ||
| Experiment for Molecule Alteration |
DNA sequencing assay | |||
| Experiment for Drug Resistance |
Disk diffusion method assay | |||
| Mechanism Description | Overexpression of CtERG11 associated with a missense mutation in this gene seemed to be responsible for the acquired azole resistance of this clinical isolate. | |||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
