Molecule Information
      General Information of the Molecule (ID: Mol00982)
  
  | Name | Kasugamycin 2' acetyltransferase (KA2A)
                                ,Paenibacillus sp.
                               | ||||
|---|---|---|---|---|---|
| Synonyms | aac(2')-IIb; AK95_15585; 2')-IIb     Click to Show/Hide | ||||
| Molecule Type | Protein | ||||
| Gene Name | aac(2')-IIb | ||||
| Sequence | MNHRKGNEPTAAALMELHVLAMFTHDGNMQIRTINEPWPGEELAPRFFMGRTIDGSSICR FRHDVPEGIAGQLRALVEDEPIVTEEVLTRPKHFAAYMNLLRAEHYTSGPCYRIPDQTTQ AKQTVRITPGNIREYSLTGFEWLTTEIDYDQPCVALIHENRVVSVCRSVRITERAHEAGL ETSEEFRGRGYAAAVVAGWAIEVQKMGALALYSTLWGNSSSRRVANKLGLSYYGVNFTIS     Click to Show/Hide | ||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
      Type(s) of Resistant Mechanism of This Molecule
  
  
      Drug Resistance Data Categorized by Drug
  
  Approved Drug(s)
      1 drug(s) in total
      
    | Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|  | ||||
| Disease Class: Bacterial infection | [1] | |||
| Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Kasugamycin | |||
| Molecule Alteration | Expression | Inherence | ||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Paenibacillus sp. LC231 | 1120679 | ||
| Experiment for Molecule Alteration | Whole genome sequence assay | |||
| Experiment for Drug Resistance | Broth microdilution method assay | |||
| Mechanism Description | Aminoglycoside acetyltransferases can often modify a variety of aminoglycosides and we therefore evaluated the ability of AAC(2')-IIb to modify a range of aminoglycosides. AAC(2')-IIb specifically modified kasugamycin and no other aminoglycoside by acetylation. | |||
      References
  
  visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
