Molecule Information
General Information of the Molecule (ID: Mol00960)
| Name |
Erythromycin resistance protein (ERM38)
,Mycolicibacterium smegmatis
|
||||
|---|---|---|---|---|---|
| Synonyms |
erm(38); 38
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
erm(38)
|
||||
| Sequence |
MSTPHHGRHELGQNFLSDRRVIADIVEIVSRTNGPIIEIGAGDGALTIPLQRLARPLTAV
EVDARRARRLAQRTARSAPGPASRPTEVVAADFLRYPLPRSPHVVVGNLPFHLTTAILRR LLHGPGWTTAVLLMQWEVARRRAAVGGATMMTAQWWPWFEFGLARKVSAASFTPRPAVDA GLLTITRRSRPLVDVADRARYQALVHRVFTGRGHGMAQILQRLPTPVPRTWLRANGIAPN SLPRQLSAAQWAALFEQTRLTGAQRVDRPRDVQHGRAHRRRGGEVDRPATHHKQTGPVVG QRQPQRGRDADADPDDQRTAPPVTRHHQGERRDEDQADHQDRPLTGEHLAGEFLWRHASF DSSASTTLVSRKARVNGPTPPGLGDT Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
5 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | [1] | |||
| Resistant Disease | Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | |||
| Resistant Drug | Clarithromycin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Mycobacterium smegmatis mc2155 | 246196 | ||
| Mycobacterium smegmatis mc2155/pMIP12 | 246196 | |||
| Mycobacterium smegmatis mc2155/pOMV20 | 246196 | |||
| Mycobacterium smegmatis mc2155/pOMV30 | 246196 | |||
| Experiment for Molecule Alteration |
MALDI mass spectrometry assay | |||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | Erm (38) is a specific dimethyltransferase. The strain obtained drug resistance by adding two methyl groups to A2058 in Mycobacterium 23SrRNA. | |||
| Disease Class: Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | [1] | |||
| Resistant Disease | Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | |||
| Resistant Drug | Clarithromycin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Mycobacterium smegmatis mc2155 | 246196 | ||
| Mycobacterium smegmatis mc2155/pMIP12 | 246196 | |||
| Mycobacterium smegmatis mc2155/pOMV20 | 246196 | |||
| Mycobacterium smegmatis mc2155/pOMV30 | 246196 | |||
| Experiment for Molecule Alteration |
MALDI mass spectrometry assay | |||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | Erm (38) is a specific dimethyltransferase. The strain obtained drug resistance by adding two methyl groups to A2058 in Mycobacterium 23SrRNA. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | [1] | |||
| Resistant Disease | Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | |||
| Resistant Drug | Clindamycin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Mycobacterium smegmatis mc2155 | 246196 | ||
| Mycobacterium smegmatis mc2155/pMIP12 | 246196 | |||
| Mycobacterium smegmatis mc2155/pOMV20 | 246196 | |||
| Mycobacterium smegmatis mc2155/pOMV30 | 246196 | |||
| Experiment for Molecule Alteration |
MALDI mass spectrometry assay | |||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | Erm (38) is a specific dimethyltransferase. The strain obtained drug resistance by adding two methyl groups to A2058 in Mycobacterium 23SrRNA. | |||
| Disease Class: Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | [1] | |||
| Resistant Disease | Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | |||
| Resistant Drug | Clindamycin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Mycobacterium smegmatis mc2155 | 246196 | ||
| Mycobacterium smegmatis mc2155/pMIP12 | 246196 | |||
| Mycobacterium smegmatis mc2155/pOMV20 | 246196 | |||
| Mycobacterium smegmatis mc2155/pOMV30 | 246196 | |||
| Experiment for Molecule Alteration |
MALDI mass spectrometry assay | |||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | Erm (38) is a specific dimethyltransferase. The strain obtained drug resistance by adding two methyl groups to A2058 in Mycobacterium 23SrRNA. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | [1] | |||
| Resistant Disease | Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | |||
| Resistant Drug | Erythromycin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Mycobacterium smegmatis mc2155 | 246196 | ||
| Mycobacterium smegmatis mc2155/pMIP12 | 246196 | |||
| Mycobacterium smegmatis mc2155/pOMV20 | 246196 | |||
| Mycobacterium smegmatis mc2155/pOMV30 | 246196 | |||
| Experiment for Molecule Alteration |
MALDI mass spectrometry assay | |||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | Erm (38) is a specific dimethyltransferase. The strain obtained drug resistance by adding two methyl groups to A2058 in Mycobacterium 23SrRNA. | |||
| Disease Class: Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | [1] | |||
| Resistant Disease | Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | |||
| Resistant Drug | Erythromycin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Mycobacterium smegmatis mc2155 | 246196 | ||
| Mycobacterium smegmatis mc2155/pMIP12 | 246196 | |||
| Mycobacterium smegmatis mc2155/pOMV20 | 246196 | |||
| Mycobacterium smegmatis mc2155/pOMV30 | 246196 | |||
| Experiment for Molecule Alteration |
MALDI mass spectrometry assay | |||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | Erm (38) is a specific dimethyltransferase. The strain obtained drug resistance by adding two methyl groups to A2058 in Mycobacterium 23SrRNA. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | [1] | |||
| Resistant Disease | Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | |||
| Resistant Drug | Quinupristin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Mycobacterium smegmatis mc2155 | 246196 | ||
| Mycobacterium smegmatis mc2155/pMIP12 | 246196 | |||
| Mycobacterium smegmatis mc2155/pOMV20 | 246196 | |||
| Mycobacterium smegmatis mc2155/pOMV30 | 246196 | |||
| Experiment for Molecule Alteration |
MALDI mass spectrometry assay | |||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | Erm (38) is a specific dimethyltransferase. The strain obtained drug resistance by adding two methyl groups to A2058 in Mycobacterium 23SrRNA. | |||
| Disease Class: Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | [1] | |||
| Resistant Disease | Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | |||
| Resistant Drug | Quinupristin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Mycobacterium smegmatis mc2155 | 246196 | ||
| Mycobacterium smegmatis mc2155/pMIP12 | 246196 | |||
| Mycobacterium smegmatis mc2155/pOMV20 | 246196 | |||
| Mycobacterium smegmatis mc2155/pOMV30 | 246196 | |||
| Experiment for Molecule Alteration |
MALDI mass spectrometry assay | |||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | Erm (38) is a specific dimethyltransferase. The strain obtained drug resistance by adding two methyl groups to A2058 in Mycobacterium 23SrRNA. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | [1] | |||
| Resistant Disease | Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | |||
| Resistant Drug | Telithromycin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Mycobacterium smegmatis mc2155 | 246196 | ||
| Mycobacterium smegmatis mc2155/pMIP12 | 246196 | |||
| Mycobacterium smegmatis mc2155/pOMV20 | 246196 | |||
| Mycobacterium smegmatis mc2155/pOMV30 | 246196 | |||
| Experiment for Molecule Alteration |
MALDI mass spectrometry assay | |||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | Erm (38) is a specific dimethyltransferase. The strain obtained drug resistance by adding two methyl groups to A2058 in Mycobacterium 23SrRNA. | |||
| Disease Class: Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | [1] | |||
| Resistant Disease | Mycobacterium smegmatis infection [ICD-11: 1B2Z.3] | |||
| Resistant Drug | Telithromycin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Mycobacterium smegmatis mc2155 | 246196 | ||
| Mycobacterium smegmatis mc2155/pMIP12 | 246196 | |||
| Mycobacterium smegmatis mc2155/pOMV20 | 246196 | |||
| Mycobacterium smegmatis mc2155/pOMV30 | 246196 | |||
| Experiment for Molecule Alteration |
MALDI mass spectrometry assay | |||
| Experiment for Drug Resistance |
MIC assay | |||
| Mechanism Description | Erm (38) is a specific dimethyltransferase. The strain obtained drug resistance by adding two methyl groups to A2058 in Mycobacterium 23SrRNA. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
