Molecule Information
General Information of the Molecule (ID: Mol00958)
| Name |
Erythromycin esterase (EREA2)
,Vibrio cholerae
|
||||
|---|---|---|---|---|---|
| Synonyms |
ereA2; Erythromycin esterase
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
ereA2
|
||||
| Sequence |
MTWRTTRTLLQPQKLEFNEFEILNPVVEGARIVGIGEGAHFVAEFSLARASLIRYFVERH
DFNAIGLECGAIQASRLSEWLNSTAGAHELERFSDTLTFSLYGSVLIWVKSYLRESGRKL QLVGIDLPNTLNPRDDLAQLAEIIQVIDHLMKPHVDALTQLLTSIDGQSAVISSAKWGEL ETAQQEKAISGVTRLKLRLASLAPVLKNHVNSDFFRKASDRIESIEYTLETLRVMKAFFD GTSLEGDTSVRDSYMAGVVDGMVRANPDVRIILLAHNNHLQKTPVSFSGELTAVPMGQHL AEREEGDYRAIAFTHLGLTVPEMHFPSPDSPLGFSVVTTPADAIREDSVEQYVIDACGKE DSCLTLTDDPMEAKRMRSQSASVETNLSEAFDAIVCVPSAGKDSLVAL Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
6 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Vibrio cholerae infection [ICD-11: 1A00.0] | [1] | |||
| Resistant Disease | Vibrio cholerae infection [ICD-11: 1A00.0] | |||
| Resistant Drug | Ampicillin | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Vibrio cholerae PG153/1 | 666 | ||
| Vibrio cholerae PG170 | 666 | |||
| Vibrio cholerae PL96 | 666 | |||
| Experiment for Molecule Alteration |
PCR and DNA sequencing assay | |||
| Experiment for Drug Resistance |
Commercial antimicrobial discs assay | |||
| Mechanism Description | The expression of dfrA5, ereA2 lead to drug resistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Vibrio cholerae infection [ICD-11: 1A00.0] | [1] | |||
| Resistant Disease | Vibrio cholerae infection [ICD-11: 1A00.0] | |||
| Resistant Drug | Chloramphenicol | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Vibrio cholerae PG153/1 | 666 | ||
| Vibrio cholerae PG170 | 666 | |||
| Experiment for Molecule Alteration |
PCR and DNA sequencing assay | |||
| Experiment for Drug Resistance |
Commercial antimicrobial discs assay | |||
| Mechanism Description | The expression of dfrA5, ereA2 lead to drug resistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Vibrio cholerae infection [ICD-11: 1A00.0] | [1] | |||
| Resistant Disease | Vibrio cholerae infection [ICD-11: 1A00.0] | |||
| Resistant Drug | Ciprofloxacin XR | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Vibrio cholerae PG153/1 | 666 | ||
| Experiment for Molecule Alteration |
PCR and DNA sequencing assay | |||
| Experiment for Drug Resistance |
Commercial antimicrobial discs assay | |||
| Mechanism Description | The expression of dfrA5, ereA2 lead to drug resistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Vibrio cholerae infection [ICD-11: 1A00.0] | [1] | |||
| Resistant Disease | Vibrio cholerae infection [ICD-11: 1A00.0] | |||
| Resistant Drug | Furazolidone | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Vibrio cholerae PG153/1 | 666 | ||
| Vibrio cholerae PG170 | 666 | |||
| Vibrio cholerae PL96 | 666 | |||
| Experiment for Molecule Alteration |
PCR and DNA sequencing assay | |||
| Experiment for Drug Resistance |
Commercial antimicrobial discs assay | |||
| Mechanism Description | The expression of dfrA5, ereA2 lead to drug resistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Vibrio cholerae infection [ICD-11: 1A00.0] | [1] | |||
| Resistant Disease | Vibrio cholerae infection [ICD-11: 1A00.0] | |||
| Resistant Drug | Nalidixic acid | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Vibrio cholerae PG153/1 | 666 | ||
| Vibrio cholerae PG170 | 666 | |||
| Experiment for Molecule Alteration |
PCR and DNA sequencing assay | |||
| Experiment for Drug Resistance |
Commercial antimicrobial discs assay | |||
| Mechanism Description | The expression of dfrA5, ereA2 lead to drug resistance. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Vibrio cholerae infection [ICD-11: 1A00.0] | [1] | |||
| Resistant Disease | Vibrio cholerae infection [ICD-11: 1A00.0] | |||
| Resistant Drug | Trimethoprim | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Vibrio cholerae PG153/1 | 666 | ||
| Vibrio cholerae PG170 | 666 | |||
| Vibrio cholerae PL96 | 666 | |||
| Experiment for Molecule Alteration |
PCR and DNA sequencing assay | |||
| Experiment for Drug Resistance |
Commercial antimicrobial discs assay | |||
| Mechanism Description | The expression of dfrA5, ereA2 lead to drug resistance. | |||
Investigative Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Vibrio cholerae infection [ICD-11: 1A00.0] | [1] | |||
| Resistant Disease | Vibrio cholerae infection [ICD-11: 1A00.0] | |||
| Resistant Drug | Sulfamethizole/Sulfadiazine | |||
| Molecule Alteration | Expression | Inherence |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| In Vitro Model | Vibrio cholerae PG153/1 | 666 | ||
| Vibrio cholerae PG170 | 666 | |||
| Vibrio cholerae PL96 | 666 | |||
| Experiment for Molecule Alteration |
PCR and DNA sequencing assay | |||
| Experiment for Drug Resistance |
Commercial antimicrobial discs assay | |||
| Mechanism Description | The expression of dfrA5, ereA2 lead to drug resistance. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
