Molecule Information
General Information of the Molecule (ID: Mol00901)
| Name |
Dihydrofolate reductase (DHFR)
,Streptococcus pyogenes
|
||||
|---|---|---|---|---|---|
| Synonyms |
DHPS; Dihydropteroate pyrophosphorylase
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
folP
|
||||
| Sequence |
MKIGKFVIDGNAAIMGILNVTPDSFSDGGSYTTVQKVLQQVDQLIAGGAKIIDVGGESTR
PGYQFVSAADEIERVVPMIKAIKAKYDVLISIDTYKTETARAALEAGADILNDVRAGLYD GEMLALAAEYDVPIILMHNQKEEVYQDVTQDVCDFLSARAQAAIDAGVPKDNIWIDPGFG FPKSVQHNMELLKGLDHVCQLGYPVLFGISRKGVVDALLGGNTKAKERDGATAALSAYAL GKGCQLVRVHDVKANQEIVAVLSQLM Click to Show/Hide
|
||||
| Function |
Catalyzes the condensation of para-aminobenzoate (pABA) with 6-hydroxymethyl-7,8-dihydropterin diphosphate (DHPt-PP) to form 7,8-dihydropteroate (H2Pte), the immediate precursor of folate derivatives.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Investigative Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Streptococcus pyogenes infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Streptococcus pyogenes infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Sulfisomidine | |||
| Molecule Alteration | Missense mutation | p.E9D+p.A37V+p.D39Q+p.H40Q+p.E42D+p.M44L+p.D47G+p.C63Y+p.T69A+p.D73E+p.V78M+p.E84A+p.N85K+p.I88V+p.W115R+p.Q122E+p.F124L+p.A132V+p.D141K+p.E147D+p.G157S+p.N158A+p.L164I+p.K171D+p.A182P+p.Q187H+p.R197H+p.R213G+p.I246L+p.D257E |
||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Streptococcus pyogenes strain G1 | 1314 | ||
| Streptococcus pyogenes strain G2 | 1314 | |||
| Streptococcus pyogenes strain G52 | 1314 | |||
| Streptococcus pyogenes strain G56 | 1314 | |||
| Streptococcus pyogenes strain G68 | 1314 | |||
| Streptococcus pyogenes strain G71 | 1314 | |||
| Streptococcus pyogenes strain G72 | 1314 | |||
| Streptococcus pyogenes strain G76 | 1314 | |||
| Experiment for Molecule Alteration |
Dideoxy-chain termination method assay | |||
| Mechanism Description | Sulfonamide resistance in recent isolates of Streptococcus pyogenes was found to be associated with alterations of the chromosomally encoded dihydropteroate synthase (DHPS). There were 111 different nucleotides (13.8%) in the genes found in susceptible and resistant isolates, respectively, resulting in 30 amino acid changes (11.3%). | |||
| Disease Class: Streptococcus pyogenes infection [ICD-11: 1A00-1C4Z] | [1] | |||
| Resistant Disease | Streptococcus pyogenes infection [ICD-11: 1A00-1C4Z] | |||
| Resistant Drug | Sulfisomidine | |||
| Molecule Alteration | Missense mutation | p.I8V+p.N11K+p.D39Q+p.H40Q+p.E42D+p.M44L+p.D47G+p.C63Y+p.T69A+p.D73E+p.V78M+p.K80I+p.E84A+p.N85K+p.I88V+p.Q122E+p.F124L+p.A132V+p.D141K+p.E147D+p.G157S+p.N158A+p.L164I+p.K171D+p.Q187H+p.R213G+p.V214I+p.I246L+p.D257E |
||
| Experimental Note | Discovered Using In-vivo Testing Model | |||
| In Vitro Model | Streptococcus pyogenes strain G1 | 1314 | ||
| Streptococcus pyogenes strain G2 | 1314 | |||
| Streptococcus pyogenes strain G52 | 1314 | |||
| Streptococcus pyogenes strain G56 | 1314 | |||
| Streptococcus pyogenes strain G68 | 1314 | |||
| Streptococcus pyogenes strain G71 | 1314 | |||
| Streptococcus pyogenes strain G72 | 1314 | |||
| Streptococcus pyogenes strain G76 | 1314 | |||
| Experiment for Molecule Alteration |
Dideoxy-chain termination method assay | |||
| Mechanism Description | Sulfonamide resistance in recent isolates of Streptococcus pyogenes was found to be associated with alterations of the chromosomally encoded dihydropteroate synthase (DHPS). There were 111 different nucleotides (13.8%) in the genes found in susceptible and resistant isolates, respectively, resulting in 30 amino acid changes (11.3%). | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
