General Information of the Molecule (ID: Mol00901)
Name
Dihydrofolate reductase (DHFR) ,Streptococcus pyogenes
Synonyms
DHPS; Dihydropteroate pyrophosphorylase
    Click to Show/Hide
Molecule Type
Protein
Gene Name
folP
Sequence
MKIGKFVIDGNAAIMGILNVTPDSFSDGGSYTTVQKVLQQVDQLIAGGAKIIDVGGESTR
PGYQFVSAADEIERVVPMIKAIKAKYDVLISIDTYKTETARAALEAGADILNDVRAGLYD
GEMLALAAEYDVPIILMHNQKEEVYQDVTQDVCDFLSARAQAAIDAGVPKDNIWIDPGFG
FPKSVQHNMELLKGLDHVCQLGYPVLFGISRKGVVDALLGGNTKAKERDGATAALSAYAL
GKGCQLVRVHDVKANQEIVAVLSQLM
    Click to Show/Hide
Function
Catalyzes the condensation of para-aminobenzoate (pABA) with 6-hydroxymethyl-7,8-dihydropterin diphosphate (DHPt-PP) to form 7,8-dihydropteroate (H2Pte), the immediate precursor of folate derivatives.
    Click to Show/Hide
Uniprot ID
DHPS_STRPY
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Lactobacillales
Family: Streptococcaceae
Genus: Streptococcus
Species: Streptococcus pyogenes
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
Drug Resistance Data Categorized by Drug
Investigative Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Sulfisomidine
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Streptococcus pyogenes infection [ICD-11: 1A00-1C4Z] [1]
Resistant Disease Streptococcus pyogenes infection [ICD-11: 1A00-1C4Z]
Resistant Drug Sulfisomidine
Molecule Alteration Missense mutation
p.E9D+p.A37V+p.D39Q+p.H40Q+p.E42D+p.M44L+p.D47G+p.C63Y+p.T69A+p.D73E+p.V78M+p.E84A+p.N85K+p.I88V+p.W115R+p.Q122E+p.F124L+p.A132V+p.D141K+p.E147D+p.G157S+p.N158A+p.L164I+p.K171D+p.A182P+p.Q187H+p.R197H+p.R213G+p.I246L+p.D257E
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Streptococcus pyogenes strain G1 1314
Streptococcus pyogenes strain G2 1314
Streptococcus pyogenes strain G52 1314
Streptococcus pyogenes strain G56 1314
Streptococcus pyogenes strain G68 1314
Streptococcus pyogenes strain G71 1314
Streptococcus pyogenes strain G72 1314
Streptococcus pyogenes strain G76 1314
Experiment for
Molecule Alteration
Dideoxy-chain termination method assay
Mechanism Description Sulfonamide resistance in recent isolates of Streptococcus pyogenes was found to be associated with alterations of the chromosomally encoded dihydropteroate synthase (DHPS). There were 111 different nucleotides (13.8%) in the genes found in susceptible and resistant isolates, respectively, resulting in 30 amino acid changes (11.3%).
Disease Class: Streptococcus pyogenes infection [ICD-11: 1A00-1C4Z] [1]
Resistant Disease Streptococcus pyogenes infection [ICD-11: 1A00-1C4Z]
Resistant Drug Sulfisomidine
Molecule Alteration Missense mutation
p.I8V+p.N11K+p.D39Q+p.H40Q+p.E42D+p.M44L+p.D47G+p.C63Y+p.T69A+p.D73E+p.V78M+p.K80I+p.E84A+p.N85K+p.I88V+p.Q122E+p.F124L+p.A132V+p.D141K+p.E147D+p.G157S+p.N158A+p.L164I+p.K171D+p.Q187H+p.R213G+p.V214I+p.I246L+p.D257E
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model Streptococcus pyogenes strain G1 1314
Streptococcus pyogenes strain G2 1314
Streptococcus pyogenes strain G52 1314
Streptococcus pyogenes strain G56 1314
Streptococcus pyogenes strain G68 1314
Streptococcus pyogenes strain G71 1314
Streptococcus pyogenes strain G72 1314
Streptococcus pyogenes strain G76 1314
Experiment for
Molecule Alteration
Dideoxy-chain termination method assay
Mechanism Description Sulfonamide resistance in recent isolates of Streptococcus pyogenes was found to be associated with alterations of the chromosomally encoded dihydropteroate synthase (DHPS). There were 111 different nucleotides (13.8%) in the genes found in susceptible and resistant isolates, respectively, resulting in 30 amino acid changes (11.3%).
References
Ref 1 Sulfonamide resistance in Streptococcus pyogenes is associated with differences in the amino acid sequence of its chromosomal dihydropteroate synthase. Antimicrob Agents Chemother. 1998 May;42(5):1062-7. doi: 10.1128/AAC.42.5.1062.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.