Molecule Information
General Information of the Molecule (ID: Mol00853)
Name |
Carboxymethylenebutenolidase (CLCD)
,Clostridium homopropionicum
|
||||
---|---|---|---|---|---|
Synonyms |
CLHOM_33680
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
clcD
|
||||
Sequence |
MKIINNSDSVIIVLHEIYGINQHIRMACEKFSTNGYDIICPNLIHVNQPFSYDLQEEAYR
HFINNIGFYSATKQVKQLILEAKEKYNHVYLLGYSIGATIAWLCSNGENMCDGIIGYYGS RIRDYMNITPKCPALLIFPTEEKSFNVQELVDSLGKCNIDAFILNGKHGFSDPFSENYCA QSFEKAERLVSNFLKK Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
4 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Clindamycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli AS19 | 562 | ||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | The Cfr RNA methyltransferase causes multiple resistances to peptidyl transferase inhibitors by methylation of A2503 23S rRNA.clcD codes the same enzyme. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Florfenicol | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli AS19 | 562 | ||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | The Cfr RNA methyltransferase causes multiple resistances to peptidyl transferase inhibitors by methylation of A2503 23S rRNA.clcD codes the same enzyme. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Linezolid | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli AS19 | 562 | ||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | The Cfr RNA methyltransferase causes multiple resistances to peptidyl transferase inhibitors by methylation of A2503 23S rRNA.clcD codes the same enzyme. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Tiamulin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Discovered Using In-vivo Testing Model | |||
In Vitro Model | Escherichia coli AS19 | 562 | ||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | The Cfr RNA methyltransferase causes multiple resistances to peptidyl transferase inhibitors by methylation of A2503 23S rRNA.clcD codes the same enzyme. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.