Molecule Information
General Information of the Molecule (ID: Mol00803)
Name |
ARE-ABC-F family resistance factor PoxtA (POXTA)
,Staphylococcus aureus
|
||||
---|---|---|---|---|---|
Synonyms |
poxtA; ARE-ABC-F family resistance factor PoxtA
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
poxtA
|
||||
Sequence |
MKGKNMNLAFGLEEIYEDAEFQIGDLDKVGIVGVNGAGKTTLFRLLLGELELDNGSLTSG
NARIGYLPQEIVLEDEDITVWDFLFEGRPIKKYEQELEEIYKKLETAVNAEQEALLARMG TLQERLEYFDFYEAETILLEFADKMSIDAELYHRPMRELSGGQKSKMAFARLLYSKPEIL LLDEPTNHLDVSTKDFVIKYLKNYRGSVLIISHDIDFLNRIINKIMYINKATHKISVYDG DYYIYKKKYAEEQRIREMAIVQQEKEIKELSDFVQKAKQASQTNHHLKRMGQERALRLDK KRGELQKRNRLYKRVKMDIRPKREGAQVPLEVENITFHYSGYPTLYQNLSFQINGRERFL VVGENGVGKSTLLKLMMGILSPDEGCIRFNQKTDIAYYAQELEQLDENKTVIDNVESEGY TPWQIRAVLSNFLFYDDDVNKKVSVLSPGEKARVALCKILLQKANLLILDEPTNHLDPET QKIIGGNFNLFEGTIIAVSHNPSFVEQIGISRMLILPSGRIEPYSRELLEYYYEINGSVA KF Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
5 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Chloramphenicol | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Staphylococcus aureus RN4220 | 1280 | ||
Enterococcus faecalis JH2-2 | 1351 | |||
Escherichia coli Mach1 T1R | 562 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Broth dilution test assay | |||
Mechanism Description | The poxtA gene encodes a protein that is 32% identical to OptrA and exhibits structural features typical of the F lineage of the ATP-binding cassette (ABC) protein superfamily that cause antibiotic resistance by ribosomal protection. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Doxycycline | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Staphylococcus aureus RN4220 | 1280 | ||
Enterococcus faecalis JH2-2 | 1351 | |||
Escherichia coli Mach1 T1R | 562 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Broth dilution test assay | |||
Mechanism Description | The poxtA gene encodes a protein that is 32% identical to OptrA and exhibits structural features typical of the F lineage of the ATP-binding cassette (ABC) protein superfamily that cause antibiotic resistance by ribosomal protection. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Florfenicol | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Staphylococcus aureus RN4220 | 1280 | ||
Enterococcus faecalis JH2-2 | 1351 | |||
Escherichia coli Mach1 T1R | 562 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Broth dilution test assay | |||
Mechanism Description | The poxtA gene encodes a protein that is 32% identical to OptrA and exhibits structural features typical of the F lineage of the ATP-binding cassette (ABC) protein superfamily that cause antibiotic resistance by ribosomal protection. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Linezolid | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Staphylococcus aureus RN4220 | 1280 | ||
Enterococcus faecalis JH2-2 | 1351 | |||
Escherichia coli Mach1 T1R | 562 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Broth dilution test assay | |||
Mechanism Description | The poxtA gene encodes a protein that is 32% identical to OptrA and exhibits structural features typical of the F lineage of the ATP-binding cassette (ABC) protein superfamily that cause antibiotic resistance by ribosomal protection. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Bacterial infection | [1] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Tetracycline | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Staphylococcus aureus RN4220 | 1280 | ||
Enterococcus faecalis JH2-2 | 1351 | |||
Escherichia coli Mach1 T1R | 562 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
Broth dilution test assay | |||
Mechanism Description | The poxtA gene encodes a protein that is 32% identical to OptrA and exhibits structural features typical of the F lineage of the ATP-binding cassette (ABC) protein superfamily that cause antibiotic resistance by ribosomal protection. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.