Molecule Information
General Information of the Molecule (ID: Mol00775)
Name |
Aminoglycoside (3'') (9) adenylyltransferase (AADA)
,Vibrio cholerae
|
||||
---|---|---|---|---|---|
Molecule Type |
Protein
|
||||
Gene Name |
aadA1
|
||||
Gene ID | |||||
Sequence |
MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPHSDIDLLVTVTVRLDE
TTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAKRELQFGEWQRNDILAG IFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLFEALNETLTLWNSPPDWA GDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQPVILEARQAYLGQEEDRLA SRADQLEEFVHYVKGEITKVVGK Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
6 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Vibrio cholerae infection | [1] | |||
Resistant Disease | Vibrio cholerae infection [ICD-11: 1A00.0] | |||
Resistant Drug | Ampicillin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Vibrio cholerae O26 strain AS482 | 567107 | ||
Vibrio cholerae O39 strain AS634 | 666 | |||
Experiment for Molecule Alteration |
PCR and DNA sequencing assay | |||
Experiment for Drug Resistance |
Commercial antimicrobial discs assay | |||
Mechanism Description | The expression of aadA1-S lead to drug resistance. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Vibrio cholerae infection | [1] | |||
Resistant Disease | Vibrio cholerae infection [ICD-11: 1A00.0] | |||
Resistant Drug | Framycetin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Vibrio cholerae O39 strain AS634 | 666 | ||
Experiment for Molecule Alteration |
PCR and DNA sequencing assay | |||
Experiment for Drug Resistance |
Commercial antimicrobial discs assay | |||
Mechanism Description | The expression of aadA1-S lead to drug resistance. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Vibrio cholerae infection | [1] | |||
Resistant Disease | Vibrio cholerae infection [ICD-11: 1A00.0] | |||
Resistant Drug | Furazolidone | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Vibrio cholerae O26 strain AS482 | 567107 | ||
Vibrio cholerae O39 strain AS634 | 666 | |||
Experiment for Molecule Alteration |
PCR and DNA sequencing assay | |||
Experiment for Drug Resistance |
Commercial antimicrobial discs assay | |||
Mechanism Description | The expression of aadA1-S lead to drug resistance. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Vibrio cholerae infection | [1] | |||
Resistant Disease | Vibrio cholerae infection [ICD-11: 1A00.0] | |||
Resistant Drug | Nalidixic acid | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Vibrio cholerae O26 strain AS482 | 567107 | ||
Experiment for Molecule Alteration |
PCR and DNA sequencing assay | |||
Experiment for Drug Resistance |
Commercial antimicrobial discs assay | |||
Mechanism Description | The expression of aadA1-S lead to drug resistance. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Vibrio cholerae infection | [1] | |||
Resistant Disease | Vibrio cholerae infection [ICD-11: 1A00.0] | |||
Resistant Drug | Streptomycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Vibrio cholerae O26 strain AS482 | 567107 | ||
Vibrio cholerae O39 strain AS634 | 666 | |||
Experiment for Molecule Alteration |
PCR and DNA sequencing assay | |||
Experiment for Drug Resistance |
Commercial antimicrobial discs assay | |||
Mechanism Description | The expression of aadA1-S lead to drug resistance. |
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Vibrio cholerae infection | [1] | |||
Resistant Disease | Vibrio cholerae infection [ICD-11: 1A00.0] | |||
Resistant Drug | Trimethoprim | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Vibrio cholerae O39 strain AS634 | 666 | ||
Experiment for Molecule Alteration |
PCR and DNA sequencing assay | |||
Experiment for Drug Resistance |
Commercial antimicrobial discs assay | |||
Mechanism Description | The expression of aadA1-S lead to drug resistance. |
Investigative Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Vibrio cholerae infection | [1] | |||
Resistant Disease | Vibrio cholerae infection [ICD-11: 1A00.0] | |||
Resistant Drug | Sulfamethizole/Sulfadiazine | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Vibrio cholerae O26 strain AS482 | 567107 | ||
Experiment for Molecule Alteration |
PCR and DNA sequencing assay | |||
Experiment for Drug Resistance |
Commercial antimicrobial discs assay | |||
Mechanism Description | The expression of aadA1-S lead to drug resistance. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.