General Information of the Molecule (ID: Mol00775)
Name
Aminoglycoside (3'') (9) adenylyltransferase (AADA) ,Vibrio cholerae
Molecule Type
Protein
Gene Name
aadA1
Gene ID
31892376
Sequence
MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPHSDIDLLVTVTVRLDE
TTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAKRELQFGEWQRNDILAG
IFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLFEALNETLTLWNSPPDWA
GDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQPVILEARQAYLGQEEDRLA
SRADQLEEFVHYVKGEITKVVGK
    Click to Show/Hide
Uniprot ID
Q6YLY2_VIBCL
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Vibrionales
Family: Vibrionaceae
Genus: Vibrio
Species: Vibrio cholerae
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
6 drug(s) in total
Click to Show/Hide the Full List of Drugs
Ampicillin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Vibrio cholerae infection [ICD-11: 1A00.0] [1]
Resistant Disease Vibrio cholerae infection [ICD-11: 1A00.0]
Resistant Drug Ampicillin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Vibrio cholerae O26 strain AS482 567107
Vibrio cholerae O39 strain AS634 666
Experiment for
Molecule Alteration
PCR and DNA sequencing assay
Experiment for
Drug Resistance
Commercial antimicrobial discs assay
Mechanism Description The expression of aadA1-S lead to drug resistance.
Framycetin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Vibrio cholerae infection [ICD-11: 1A00.0] [1]
Resistant Disease Vibrio cholerae infection [ICD-11: 1A00.0]
Resistant Drug Framycetin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Vibrio cholerae O39 strain AS634 666
Experiment for
Molecule Alteration
PCR and DNA sequencing assay
Experiment for
Drug Resistance
Commercial antimicrobial discs assay
Mechanism Description The expression of aadA1-S lead to drug resistance.
Furazolidone
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Vibrio cholerae infection [ICD-11: 1A00.0] [1]
Resistant Disease Vibrio cholerae infection [ICD-11: 1A00.0]
Resistant Drug Furazolidone
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Vibrio cholerae O26 strain AS482 567107
Vibrio cholerae O39 strain AS634 666
Experiment for
Molecule Alteration
PCR and DNA sequencing assay
Experiment for
Drug Resistance
Commercial antimicrobial discs assay
Mechanism Description The expression of aadA1-S lead to drug resistance.
Nalidixic acid
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Vibrio cholerae infection [ICD-11: 1A00.0] [1]
Resistant Disease Vibrio cholerae infection [ICD-11: 1A00.0]
Resistant Drug Nalidixic acid
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Vibrio cholerae O26 strain AS482 567107
Experiment for
Molecule Alteration
PCR and DNA sequencing assay
Experiment for
Drug Resistance
Commercial antimicrobial discs assay
Mechanism Description The expression of aadA1-S lead to drug resistance.
Streptomycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Vibrio cholerae infection [ICD-11: 1A00.0] [1]
Resistant Disease Vibrio cholerae infection [ICD-11: 1A00.0]
Resistant Drug Streptomycin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Vibrio cholerae O26 strain AS482 567107
Vibrio cholerae O39 strain AS634 666
Experiment for
Molecule Alteration
PCR and DNA sequencing assay
Experiment for
Drug Resistance
Commercial antimicrobial discs assay
Mechanism Description The expression of aadA1-S lead to drug resistance.
Trimethoprim
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Vibrio cholerae infection [ICD-11: 1A00.0] [1]
Resistant Disease Vibrio cholerae infection [ICD-11: 1A00.0]
Resistant Drug Trimethoprim
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Vibrio cholerae O39 strain AS634 666
Experiment for
Molecule Alteration
PCR and DNA sequencing assay
Experiment for
Drug Resistance
Commercial antimicrobial discs assay
Mechanism Description The expression of aadA1-S lead to drug resistance.
Investigative Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Sulfamethizole/Sulfadiazine
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Vibrio cholerae infection [ICD-11: 1A00.0] [1]
Resistant Disease Vibrio cholerae infection [ICD-11: 1A00.0]
Resistant Drug Sulfamethizole/Sulfadiazine
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Vibrio cholerae O26 strain AS482 567107
Experiment for
Molecule Alteration
PCR and DNA sequencing assay
Experiment for
Drug Resistance
Commercial antimicrobial discs assay
Mechanism Description The expression of aadA1-S lead to drug resistance.
References
Ref 1 Occurrence of antibiotic resistance gene cassettes aac(6')-Ib, dfrA5, dfrA12, and ereA2 in class I integrons in non-O1, non-O139 Vibrio cholerae strains in India. Antimicrob Agents Chemother. 2002 Sep;46(9):2948-55. doi: 10.1128/AAC.46.9.2948-2955.2002.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.