Molecule Information

General Information of the Molecule (ID: Mol00730)

• Name: Protein pexA (PEXA) ,Escherichia coli
• Synonyms: pexA; AKSOIL_0345; PexA
• Molecule Type: Protein
• Gene Name: pexA
• Sequence:
  MKKFVLFCERNGIALIPIVLILLGCGLWPEMELLVPSLPDMQRAFNIQDAQIQQLLTANF
  VGFLIGVLFAGPLCDSAGRRTVMMIGTIGYLVSSVLCPFCNDFVLLMIARFFQGLFMTGP
  VIAGGVLLMEATEGVKQIFWMSIGNAAITFCMAAGPIVGSWINTGFGYVGNLWSILILGL
  IGCLPALFLVPESLPVEKRAAFHPKLLFKGYFALLKDFRFMCLAIPMCALAAAYWIYVGV
  SALYMVNQLGIAQEMFGRYQGPIVGCFSIISLGSSKLLQRFGLMKCLRAGIVSMFTGMLL
  LLGMSILSLDHAVATTVFMMFFVGGMAPICSMLFPYALGHLPVDLKGNAQAMVQAIRLFF
  ASIGTSLVGVFYKSAFLPVALIMFAILLFSCYFLWKGRRYLKEGLGADHILSVGH
• Uniprot ID: D9MX76_9BACT

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Escherichia
Species: Escherichia coli

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s) 2 drug(s) in total

Chloramphenicol

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Bacterial infection [1]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Chloramphenicol
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli; 668369
• Experiment for Molecule Alteration: Nucleotide sequence assay
• Experiment for Drug Resistance: Broth microdilution assay
• Mechanism Description: In its natural host, pexA could provide protection against chloramphenicol and florfenicol excreted by Streptomyces spp.

Florfenicol

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Bacterial infection [1]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Florfenicol
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli; 668369
• Experiment for Molecule Alteration: Nucleotide sequence assay
• Experiment for Drug Resistance: Broth microdilution assay
• Mechanism Description: In its natural host, pexA could provide protection against chloramphenicol and florfenicol excreted by Streptomyces spp.

References

• Ref 1: Novel florfenicol and chloramphenicol resistance gene discovered in Alaskan soil by using functional metagenomics. Appl Environ Microbiol. 2010 Aug;76(15):5321-6. doi: 10.1128/AEM.00323-10. Epub 2010 Jun 11.