Molecule Information

General Information of the Molecule (ID: Mol00675)

• Name: Transmembrane protein 54 (TMM54) ,Homo sapiens
• Synonyms: Beta-casein-like protein; Protein CAC-1; BCLP; CAC1
• Molecule Type: Protein
• Gene Name: TMEM54
• Gene ID: 113452
• Location: chr1:32894594-32901438[-]
• Sequence:
  MCLRLGGLSVGDFRKVLMKTGLVLVVLGHVSFITAALFHGTVLRYVGTPQDAVALQYCVV
  NILSVTSAIVVITSGIAAIVLSRYLPSTPLRWTVFSSSVACALLSLTCALGLLASIAMTF
  ATQGKALLAACTFGSSELLALAPDCPFDPTRIYSSSLCLWGIALVLCVAENVFAVRCAQL
  THQLLELRPWWGKSSHHMMRENPELVEGRDLLSCTSSEPLTL
• Uniprot ID: TMM54_HUMAN
• Ensembl ID: ENSG00000121900
• HGNC ID: HGNC:24143

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Vincristine

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Colorectal cancer [1]

• Sensitive Disease: Colorectal cancer [ICD-11: 2B91.1]
• Sensitive Drug: Vincristine
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Identified from the Human Clinical Data
• Cell Pathway Regulation: Cell apoptosis; Activation; hsa04210
• Cell Pathway Regulation: Cell migration; Inhibition; hsa04670
• Cell Pathway Regulation: Cell proliferation; Inhibition; hsa05200
• In Vitro Model: HCT-8 cells; Colon; Homo sapiens (Human); CVCL_2478
• In Vivo Model: BALB/c nude mouse xenograft model; Mus musculus
• Experiment for Molecule Alteration: Western blotting analysis
• Experiment for Drug Resistance: MTT assay
• Mechanism Description: miR-199a-5p over-expression is able to inhibit CRC cell proliferation and reverse tumor cell drug resistance in vitro and in vivo, partly through suppressing the expression of CAC1 protein at the post-transcriptional level in CRC.

References

• Ref 1: The deoxycholic acid targets miRNA-dependent CAC1 gene expression in multidrug resistance of human colorectal cancer. Int J Biochem Cell Biol. 2012 Dec;44(12):2321-32. doi: 10.1016/j.biocel.2012.08.006. Epub 2012 Aug 10.