Molecule Information
General Information of the Molecule (ID: Mol00652)
Name |
START domain-containing protein 10 (STARD10)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
StARD10; Antigen NY-CO-28; PCTP-like protein; PCTP-L; Serologically defined colon cancer antigen 28; StAR-related lipid transfer protein 10; SDCCAG28; CGI-52
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
STARD10
|
||||
Gene ID | |||||
Location |
chr11:72754729-72794047[-]
|
||||
Sequence |
MEKLAASTEPQGPRPVLGRESVQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVE
MDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWR CPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKS CVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPE QSPLPSLALSELSVQHADSLENIDESAVAESREERMGGAGGEGSDDDTSLT Click to Show/Hide
|
||||
Function |
May play metabolic roles in sperm maturation or fertilization (By similarity). Phospholipid transfer protein that preferentially selects lipid species containing a palmitoyl or stearoyl chain on the sn-1 and an unsaturated fatty acyl chain (18:1 or 18:2) on the sn-2 position. Able to transfer phosphatidylcholine (PC) and phosphatidyetanolamline (PE) between membranes.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Breast cancer | [1] | |||
Sensitive Disease | Breast cancer [ICD-11: 2C60.3] | |||
Sensitive Drug | Docetaxel | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | STARD10 signaling pathway | Inhibition | hsa05206 | |
In Vitro Model | MCF-7 cells | Breast | Homo sapiens (Human) | CVCL_0031 |
MDA-MB-231 cells | Breast | Homo sapiens (Human) | CVCL_0062 | |
T47D cells | Breast | Homo sapiens (Human) | CVCL_0553 | |
MDA-MB-468 cells | Breast | Homo sapiens (Human) | CVCL_0419 | |
Experiment for Molecule Alteration |
RT-qPCR; Immunoblotting assay; Luciferase assay | |||
Experiment for Drug Resistance |
ELISA; MTT assay; Transwell invasion assay | |||
Mechanism Description | Acquired resistance to DTX is caused by the miR638 deficiency and subsequent STARD10 upregulation. |
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Breast tissue | |
The Specified Disease | Breast cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.42E-62; Fold-change: 1.37E+00; Z-score: 1.54E+00 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.45E-08; Fold-change: 1.02E+00; Z-score: 7.43E-01 | |
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.