Molecule Information
General Information of the Molecule (ID: Mol00622)
| Name |
Syndecan-2 (SDC2)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Molecule Type |
Protein
|
||||
| Gene Name |
SDC2
|
||||
| Gene ID | |||||
| Location |
chr8:96493813-96611790[+]
|
||||
| Sequence |
MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGAD
EDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERK MDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYD LGERKPSSAAYQKAPTKEFYA Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Cell surface proteoglycan that bears heparan sulfate. Regulates dendritic arbor morphogenesis (By similarity).
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Osteosarcoma [ICD-11: 2B51.0] | [1] | |||
| Resistant Disease | Osteosarcoma [ICD-11: 2B51.0] | |||
| Resistant Drug | Doxorubicin | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | G-292 cells | Bone | Homo sapiens (Human) | CVCL_2909 |
| SJSA-1 cells | Bone | Homo sapiens (Human) | CVCL_1697 | |
| Experiment for Molecule Alteration |
Luciferase reporter assay; Western blot analysis | |||
| Experiment for Drug Resistance |
CCK8 assay; Flow cytometry assay | |||
| Mechanism Description | miR20a-5p modulates multi-drug resistance by repressing SDC2 expression in OS cells. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Osteosarcoma [ICD-11: 2B51.0] | [1] | |||
| Resistant Disease | Osteosarcoma [ICD-11: 2B51.0] | |||
| Resistant Drug | Etoposide | |||
| Molecule Alteration | Expression | Up-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | G-292 cells | Bone | Homo sapiens (Human) | CVCL_2909 |
| SJSA-1 cells | Bone | Homo sapiens (Human) | CVCL_1697 | |
| Experiment for Molecule Alteration |
Luciferase reporter assay; Western blot analysis | |||
| Experiment for Drug Resistance |
CCK8 assay; Flow cytometry assay | |||
| Mechanism Description | miR20a-5p modulates multi-drug resistance by repressing SDC2 expression in OS cells. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
