Molecule Information

General Information of the Molecule (ID: Mol00601)

• Name: Rho-related GTP-binding protein RhoB (RHOB) ,Homo sapiens
• Synonyms: Rho cDNA clone 6; h6; ARH6; ARHB
• Molecule Type: Protein
• Gene Name: RHOB
• Gene ID: 388
• Location: chr2:20447074-20449440[+]
• Sequence:
  MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDT
  AGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKD
  LRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQ
  KRYGSQNGCINCCKVL
• 3D-structure: PDB ID: 2FV8; Classification: Signaling protein; Method: X-ray diffraction; Resolution: 1.90 Å
• Function: Mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. Involved in intracellular protein trafficking of a number of proteins. Targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Required for genotoxic stress-induced cell death in breast cancer cells.
• Uniprot ID: RHOB_HUMAN
• Ensembl ID: ENSG00000143878
• HGNC ID: HGNC:668

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  RTDM: Regulation by the Disease Microenvironment

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Doxorubicin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Regulation by the Disease Microenvironment (RTDM)

Disease Class: Breast cancer [ICD-11: 2C60.3] [1]

• Resistant Disease: Breast cancer [ICD-11: 2C60.3]
• Resistant Drug: Doxorubicin
• Molecule Alteration: Expression; Up-regulation

Differential expression of the molecule in resistant disease

• Classification of Disease: Breast cancer [ICD-11: 2C60]
• The Specified Disease: Breast cancer
• The Studied Tissue: Breast tissue
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 9.79E-05; Fold-change: 2.43E-02; Z-score: 3.94E+00
• Experimental Note: Revealed Based on the Cell Line Data
• Cell Pathway Regulation: TGF-beta/Wnt/G protein signaling pathway; Regulation; N.A.
• In Vitro Model: MCF-7 cells; Breast; Homo sapiens (Human); CVCL_0031
• Experiment for Molecule Alteration: Western blot analysis
• Experiment for Drug Resistance: MTT assay
• Mechanism Description: miR-760 enchance the expression of RHOB and RHOB overexpression was suggested to be associated angiogenesis and tumor progression in breast cancer,which can cause resistance in the cancer cells.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Breast cancer [ICD-11: 2C60]

Differential expression of molecule in resistant diseases

• The Studied Tissue: Breast tissue
• The Specified Disease: Breast cancer
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 9.79E-05; Fold-change: 1.76E-01; Z-score: 5.09E-01
• The Expression Level of Disease Section Compare with the Adjacent Tissue: p-value: 3.52E-01; Fold-change: 7.60E-03; Z-score: 3.41E-02

References

• Ref 1: Systematic analysis of gene expression pattern in has-miR-760 overexpressed resistance of the MCF-7 human breast cancer cell to doxorubicin. Biomed Pharmacother. 2015 Feb;69:162-9. doi: 10.1016/j.biopha.2014.11.028. Epub 2014 Nov 25.