General Information of the Molecule (ID: Mol00590)
Name
Ras association domain-containing protein 1 (RASSF1) ,Homo sapiens
Synonyms
RDA32
    Click to Show/Hide
Molecule Type
Protein
Gene Name
RASSF1
Gene ID
11186
Location
chr3:50329782-50340980[-]
Sequence
MSGEPELIELRELAPAGRAGKGRTRLERANALRIARGTACNPTRQLVPGRGHRFQPAGPA
THTWCDLCGDFIWGVVRKGLQCARLSADCKFTCHYRCRALVCLDCCGPRDLGWEPAVERD
TNVDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSV
PSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVV
DDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALSFVLKENDSGEVNWDAF
SMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
    Click to Show/Hide
3D-structure
PDB ID
2KZU
Classification
Apoptosis
Method
Solution nmr
Resolution
No Resolution Dat Å
Function
Potential tumor suppressor. Required for death receptor-dependent apoptosis. Mediates activation of STK3/MST2 and STK4/MST1 during Fas-induced apoptosis by preventing their dephosphorylation. When associated with MOAP1, promotes BAX conformational change and translocation to mitochondrial membranes in response to TNF and TNFSF10 stimulation. Isoform A interacts with CDC20, an activator of the anaphase-promoting complex, APC, resulting in the inhibition of APC activity and mitotic progression. Inhibits proliferation by negatively regulating cell cycle progression at the level of G1/S-phase transition by regulating accumulation of cyclin D1 protein. Isoform C has been shown not to perform these roles, no function has been identified for this isoform. Isoform A disrupts interactions among MDM2, DAXX and USP7, thus contributing to the efficient activation of TP53 by promoting MDM2 self-ubiquitination in cell-cycle checkpoint control in response to DNA damage.
    Click to Show/Hide
Uniprot ID
RASF1_HUMAN
Ensembl ID
ENSG00000068028
HGNC ID
HGNC:9882
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  EADR: Epigenetic Alteration of DNA, RNA or Protein
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Sorafenib
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Hepatocellular carcinoma [ICD-11: 2C12.2] [1]
Sensitive Disease Hepatocellular carcinoma [ICD-11: 2C12.2]
Sensitive Drug Sorafenib
Molecule Alteration Expression
Up-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Liver cancer [ICD-11: 2C12]
The Specified Disease Liver cancer
The Studied Tissue Liver tissue
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 1.26E-03
Fold-change: 3.99E-02
Z-score: 3.40E+00
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell apoptosis Activation hsa04210
Cell proliferation Inhibition hsa05200
MAPK signaling pathway Inhibition hsa04010
In Vitro Model HepG2 cells Liver Homo sapiens (Human) CVCL_0027
Hep3B cells Liver Homo sapiens (Human) CVCL_0326
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
Caspase 3/7 activity analysis; CCK8 assay
Mechanism Description miR-181a induces sorafenib resistance of hepatocellular carcinoma cells through downregulation of RASSF1 expression.
Cisplatin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Epigenetic Alteration of DNA, RNA or Protein (EADR) Click to Show/Hide
Disease Class: Germ cell tumor [ICD-11: 2D12.Y] [2]
Resistant Disease Germ cell tumor [ICD-11: 2D12.Y]
Resistant Drug Cisplatin
Molecule Alteration Methylation
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model 833K-E cells Ascites Homo sapiens (Human) CVCL_2292
Experiment for
Molecule Alteration
Western blotting assay
Mechanism Description Promoter hypermethylation of RASSF1A and HIC1 genes play a role in resistance of GCT, while the transcriptional inactivation of MGMT by epigenetic alterations confer exquisite sensitivity to cisplatin.
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Click to Show/Hide the Resistance Disease of This Class
Liver cancer [ICD-11: 2C12]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Liver
The Specified Disease Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.26E-03; Fold-change: 1.65E-01; Z-score: 4.92E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 4.63E-02; Fold-change: -1.32E-01; Z-score: -2.61E-01
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 4.31E-01; Fold-change: 2.72E-01; Z-score: 3.70E-01
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Molecule expression in tissue other than the diseased tissue of patients
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Tissue-specific Molecule Abundances in Healthy Individuals
Click to Show/Hide the Molecule Abundances
References
Ref 1 miR-181a induces sorafenib resistance of hepatocellular carcinoma cells through downregulation of RASSF1 expression. Cancer Sci. 2016 Sep;107(9):1256-62. doi: 10.1111/cas.13006. Epub 2016 Sep 2.
Ref 2 Role of promoter hypermethylation in Cisplatin treatment response of male germ cell tumors .Mol Cancer. 2004 May 18;3:16. doi: 10.1186/1476-4598-3-16. 10.1186/1476-4598-3-16

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.