Molecule Information
General Information of the Molecule (ID: Mol00581)
| Name |
Protein quaking (QKI)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Hqk; HqkI; HKQ
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
QKI
|
||||
| Gene ID | |||||
| Location |
chr6:163414000-163578592[+]
|
||||
| Sequence |
MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDT
LNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCK IMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLV PAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAA LRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSI LEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
RNA-binding protein that plays a central role in myelinization. Binds to the 5'-NACUAAY-N(1,20)-UAAY-3' RNA core sequence. Regulates target mRNA stability. In addition, acts by regulating pre-mRNA splicing, mRNA export and protein translation. Required to protect and promote stability of mRNAs such as MBP and CDKN1B. Regulator of oligodendrocyte differentiation and maturation in the brain that may play a role in myelin and oligodendrocyte dysfunction in schizophrenia. Participates in mRNA transport by regulating the nuclear export of MBP mRNA. Also involved in regulation of mRNA splicing of MAG pre-mRNA. Acts as a translational repressor.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Endometrial cancer [ICD-11: 2C76.1] | [1] | |||
| Sensitive Disease | Endometrial cancer [ICD-11: 2C76.1] | |||
| Sensitive Drug | Epothilone B | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Endometrial cancer [ICD-11: 2C76] | |||
| The Specified Disease | Endometrial cancer | |||
| The Studied Tissue | Uterus | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.05E-34 Fold-change: -6.23E-01 Z-score: -1.68E+01 |
|||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell migration | Inhibition | hsa04670 | |
| In Vitro Model | Hec50 cells | Endometrium | Homo sapiens (Human) | CVCL_2929 |
| Experiment for Molecule Alteration |
Immunoblotting analysis | |||
| Experiment for Drug Resistance |
ELISA assay | |||
| Mechanism Description | Low or absent miR-200c results in aberrant expression of ZEB1 and consequent repression of E-cadherin. Reinstatement of miR-200c to such cells restores E-cadherin and dramatically reduces migration and invasion. One such gene, class IIIbeta-tubulin (TUBB3), which encodes a tubulin isotype normally found only in neuronal cells, is a direct target of miR-200c. Restoration of miR-200c increases sensitivity to microtubule-targeting agents by up to 85%. Since expression of TUBB3 is a common mechanism of resistance to microtubule-binding chemotherapeutic agents in many types of solid tumors, the ability of miR-200c to restore chemosensitivity to such agents may be explained by its ability to reduce TUBB3. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Endometrial cancer [ICD-11: 2C76.1] | [1] | |||
| Sensitive Disease | Endometrial cancer [ICD-11: 2C76.1] | |||
| Sensitive Drug | Paclitaxel | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Endometrial cancer [ICD-11: 2C76] | |||
| The Specified Disease | Endometrial cancer | |||
| The Studied Tissue | Uterus | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.05E-34 Fold-change: -6.23E-01 Z-score: -1.68E+01 |
|||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell migration | Inhibition | hsa04670 | |
| In Vitro Model | Hec50 cells | Endometrium | Homo sapiens (Human) | CVCL_2929 |
| Experiment for Molecule Alteration |
Immunoblotting analysis | |||
| Experiment for Drug Resistance |
ELISA assay | |||
| Mechanism Description | Low or absent miR-200c results in aberrant expression of ZEB1 and consequent repression of E-cadherin. Reinstatement of miR-200c to such cells restores E-cadherin and dramatically reduces migration and invasion. One such gene, class IIIbeta-tubulin (TUBB3), which encodes a tubulin isotype normally found only in neuronal cells, is a direct target of miR-200c. Restoration of miR-200c increases sensitivity to microtubule-targeting agents by up to 85%. Since expression of TUBB3 is a common mechanism of resistance to microtubule-binding chemotherapeutic agents in many types of solid tumors, the ability of miR-200c to restore chemosensitivity to such agents may be explained by its ability to reduce TUBB3. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Endometrial cancer [ICD-11: 2C76.1] | [1] | |||
| Sensitive Disease | Endometrial cancer [ICD-11: 2C76.1] | |||
| Sensitive Drug | Vincristine | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Endometrial cancer [ICD-11: 2C76] | |||
| The Specified Disease | Endometrial cancer | |||
| The Studied Tissue | Uterus | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.05E-34 Fold-change: -6.23E-01 Z-score: -1.68E+01 |
|||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell migration | Inhibition | hsa04670 | |
| In Vitro Model | Hec50 cells | Endometrium | Homo sapiens (Human) | CVCL_2929 |
| Experiment for Molecule Alteration |
Immunoblotting analysis | |||
| Experiment for Drug Resistance |
ELISA assay | |||
| Mechanism Description | Low or absent miR-200c results in aberrant expression of ZEB1 and consequent repression of E-cadherin. Reinstatement of miR-200c to such cells restores E-cadherin and dramatically reduces migration and invasion. One such gene, class IIIbeta-tubulin (TUBB3), which encodes a tubulin isotype normally found only in neuronal cells, is a direct target of miR-200c. Restoration of miR-200c increases sensitivity to microtubule-targeting agents by up to 85%. Since expression of TUBB3 is a common mechanism of resistance to microtubule-binding chemotherapeutic agents in many types of solid tumors, the ability of miR-200c to restore chemosensitivity to such agents may be explained by its ability to reduce TUBB3. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
