General Information of the Molecule (ID: Mol00581)
Name
Protein quaking (QKI) ,Homo sapiens
Synonyms
Hqk; HqkI; HKQ
    Click to Show/Hide
Molecule Type
Protein
Gene Name
QKI
Gene ID
9444
Location
chr6:163414000-163578592[+]
Sequence
MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDT
LNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCK
IMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLV
PAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAA
LRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSI
LEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN
    Click to Show/Hide
3D-structure
PDB ID
4JVH
Classification
Rna binding protein
Method
X-ray diffraction
Resolution
3.50  Å
Function
RNA-binding protein that plays a central role in myelinization. Binds to the 5'-NACUAAY-N(1,20)-UAAY-3' RNA core sequence. Regulates target mRNA stability. In addition, acts by regulating pre-mRNA splicing, mRNA export and protein translation. Required to protect and promote stability of mRNAs such as MBP and CDKN1B. Regulator of oligodendrocyte differentiation and maturation in the brain that may play a role in myelin and oligodendrocyte dysfunction in schizophrenia. Participates in mRNA transport by regulating the nuclear export of MBP mRNA. Also involved in regulation of mRNA splicing of MAG pre-mRNA. Acts as a translational repressor.
    Click to Show/Hide
Uniprot ID
QKI_HUMAN
Ensembl ID
ENSG00000112531
HGNC ID
HGNC:21100
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  RTDM: Regulation by the Disease Microenvironment
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
Click to Show/Hide the Full List of Drugs
Epothilone B
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Regulation by the Disease Microenvironment (RTDM) Click to Show/Hide
Disease Class: Endometrial cancer [ICD-11: 2C76.1] [1]
Sensitive Disease Endometrial cancer [ICD-11: 2C76.1]
Sensitive Drug Epothilone B
Molecule Alteration Expression
Down-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Endometrial cancer [ICD-11: 2C76]
The Specified Disease Endometrial cancer
The Studied Tissue Uterus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 1.05E-34
Fold-change: -6.23E-01
Z-score: -1.68E+01
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell migration Inhibition hsa04670
In Vitro Model Hec50 cells Endometrium Homo sapiens (Human) CVCL_2929
Experiment for
Molecule Alteration
Immunoblotting analysis
Experiment for
Drug Resistance
ELISA assay
Mechanism Description Low or absent miR-200c results in aberrant expression of ZEB1 and consequent repression of E-cadherin. Reinstatement of miR-200c to such cells restores E-cadherin and dramatically reduces migration and invasion. One such gene, class IIIbeta-tubulin (TUBB3), which encodes a tubulin isotype normally found only in neuronal cells, is a direct target of miR-200c. Restoration of miR-200c increases sensitivity to microtubule-targeting agents by up to 85%. Since expression of TUBB3 is a common mechanism of resistance to microtubule-binding chemotherapeutic agents in many types of solid tumors, the ability of miR-200c to restore chemosensitivity to such agents may be explained by its ability to reduce TUBB3.
Paclitaxel
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Regulation by the Disease Microenvironment (RTDM) Click to Show/Hide
Disease Class: Endometrial cancer [ICD-11: 2C76.1] [1]
Sensitive Disease Endometrial cancer [ICD-11: 2C76.1]
Sensitive Drug Paclitaxel
Molecule Alteration Expression
Down-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Endometrial cancer [ICD-11: 2C76]
The Specified Disease Endometrial cancer
The Studied Tissue Uterus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 1.05E-34
Fold-change: -6.23E-01
Z-score: -1.68E+01
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell migration Inhibition hsa04670
In Vitro Model Hec50 cells Endometrium Homo sapiens (Human) CVCL_2929
Experiment for
Molecule Alteration
Immunoblotting analysis
Experiment for
Drug Resistance
ELISA assay
Mechanism Description Low or absent miR-200c results in aberrant expression of ZEB1 and consequent repression of E-cadherin. Reinstatement of miR-200c to such cells restores E-cadherin and dramatically reduces migration and invasion. One such gene, class IIIbeta-tubulin (TUBB3), which encodes a tubulin isotype normally found only in neuronal cells, is a direct target of miR-200c. Restoration of miR-200c increases sensitivity to microtubule-targeting agents by up to 85%. Since expression of TUBB3 is a common mechanism of resistance to microtubule-binding chemotherapeutic agents in many types of solid tumors, the ability of miR-200c to restore chemosensitivity to such agents may be explained by its ability to reduce TUBB3.
Vincristine
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Regulation by the Disease Microenvironment (RTDM) Click to Show/Hide
Disease Class: Endometrial cancer [ICD-11: 2C76.1] [1]
Sensitive Disease Endometrial cancer [ICD-11: 2C76.1]
Sensitive Drug Vincristine
Molecule Alteration Expression
Down-regulation
Differential expression of the molecule in resistant disease
Classification of Disease Endometrial cancer [ICD-11: 2C76]
The Specified Disease Endometrial cancer
The Studied Tissue Uterus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue
p-value: 1.05E-34
Fold-change: -6.23E-01
Z-score: -1.68E+01
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell migration Inhibition hsa04670
In Vitro Model Hec50 cells Endometrium Homo sapiens (Human) CVCL_2929
Experiment for
Molecule Alteration
Immunoblotting analysis
Experiment for
Drug Resistance
ELISA assay
Mechanism Description Low or absent miR-200c results in aberrant expression of ZEB1 and consequent repression of E-cadherin. Reinstatement of miR-200c to such cells restores E-cadherin and dramatically reduces migration and invasion. One such gene, class IIIbeta-tubulin (TUBB3), which encodes a tubulin isotype normally found only in neuronal cells, is a direct target of miR-200c. Restoration of miR-200c increases sensitivity to microtubule-targeting agents by up to 85%. Since expression of TUBB3 is a common mechanism of resistance to microtubule-binding chemotherapeutic agents in many types of solid tumors, the ability of miR-200c to restore chemosensitivity to such agents may be explained by its ability to reduce TUBB3.
References
Ref 1 MicroRNA-200c mitigates invasiveness and restores sensitivity to microtubule-targeting chemotherapeutic agents. Mol Cancer Ther. 2009 May;8(5):1055-66. doi: 10.1158/1535-7163.MCT-08-1046. Epub 2009 May 12.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.