Molecule Information

General Information of the Molecule (ID: Mol00544)

Name	Tumor protein p73 (TP73) ,Homo sapiens
Synonyms	p53-like transcription factor; p53-related protein; P73 Click to Show/Hide
Molecule Type	Protein
Gene Name	TP73
Gene ID	7161
Location	chr1:3652516-3736201[+]
Sequence	MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTS VMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPVIPSNTD YPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPV YKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPY EPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGR DRKADEDHYREQQALNESSAKNGAASKRAFKQSPPAVPALGAGVKKRRHGDEDTYYLQVR GRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQRPSHLQPPSYGPVLSPMNKVHGG MNKLPSVNQLVGQPPPHSSAATPNLGPVGPGMLNNHGHAVPANGEMSSSHSAQSMVSGSH CTPPPPYHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMT IWRGLQDLKQGHDYSTAQQLLRSSNAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRG GPGGGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH Click to Show/Hide
Function	Participates in the apoptotic response to DNA damage. Isoforms containing the transactivation domain are pro-apoptotic, isoforms lacking the domain are anti-apoptotic and block the function of p53 and transactivating p73 isoforms. May be a tumor suppressor protein. Click to Show/Hide
Uniprot ID	P73_HUMAN
Ensembl ID	ENSG00000078900
HGNC ID	HGNC:12003
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

2 drug(s) in total

Click to Show/Hide the Full List of Drugs

Docetaxel

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Prostate cancer				[1]
Resistant Disease	Prostate cancer [ICD-11: 2C82.0]			Disease Info
Resistant Drug	Docetaxel			Drug Info
Molecule Alteration	Expression		Down-regulation
Experimental Note	Revealed Based on the Cell Line Data
In Vitro Model	DU-145 cells	Prostate	Homo sapiens (Human)	CVCL_0105
	PC3 cells	Prostate	Homo sapiens (Human)	CVCL_0035
In Vivo Model	Nude mouse xenograft model			Mus musculus
Experiment for Molecule Alteration	Luciferase reporter assay; Western blot analysis
Experiment for Drug Resistance	MTT assay; Flow cytometric analysis
Mechanism Description	microRNA-323 upregulation promotes prostate cancer growth and docetaxel resistance by repressing p73.

Tamoxifen

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Breast cancer				[2]
Resistant Disease	Breast cancer [ICD-11: 2C60.3]			Disease Info
Resistant Drug	Tamoxifen			Drug Info
Molecule Alteration	Expression		Down-regulation
Experimental Note	Revealed Based on the Cell Line Data
Cell Pathway Regulation	Cell apoptosis		Inhibition	hsa04210
	Cell proliferation		Activation	hsa05200
In Vitro Model	MCF-7 cells	Breast	Homo sapiens (Human)	CVCL_0031
Experiment for Molecule Alteration	Western blot analysis; RIP assay; Luciferase reporter assay
Experiment for Drug Resistance	MTT assay; Flow cytometry assay
Mechanism Description	microRNA 663b mediates TAM resistance in breast cancer by downrerulating TP73 expression.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Click to Show/Hide the Resistance Disease of This Class

Breast cancer [ICD-11: 2C60]

Click to Show/Hide

Differential expression of molecule in resistant diseases
The Studied Tissue	Breast tissue
The Specified Disease	Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.09E-04; Fold-change: -7.63E-02; Z-score: -2.99E-01
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.22E-01; Fold-change: -1.93E-02; Z-score: -5.80E-02
Molecule expression in the normal tissue adjacent to the diseased tissue of patients Molecule expression in the diseased tissue of patients Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances		Click to View the Clearer Original Diagram
Download Molecule expression barchart for all samples Download Molecule expression data of patients in the normal section of the tissue adjacent to the disease section Download Molecule expression data of patients in the disease section of the tissue Download Molecule expression data in the tissue of healthy individual

Prostate cancer [ICD-11: 2C82]

Click to Show/Hide

Differential expression of molecule in resistant diseases
The Studied Tissue	Prostate
The Specified Disease	Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.84E-04; Fold-change: -4.85E-01; Z-score: -1.12E+00
Molecule expression in the diseased tissue of patients Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances		Click to View the Clearer Original Diagram
Download Molecule expression barchart for all samples Download Molecule expression data of patients in the disease section of the tissue Download Molecule expression data in the tissue of healthy individual

Tissue-specific Molecule Abundances in Healthy Individuals

Click to Show/Hide the Molecule Abundances


Download the Tissue-Specific Variation(s) Profile

References

Ref 1	microRNA-323 upregulation promotes prostate cancer growth and docetaxel resistance by repressing p73. Biomed Pharmacother. 2018 Jan;97:528-534. doi: 10.1016/j.biopha.2017.10.040. Epub 2017 Nov 6.
Ref 2	MicroRNA 663b mediates TAM resistance in breast cancer by modulating TP73 expression. Mol Med Rep. 2018 Jul;18(1):1120-1126. doi: 10.3892/mmr.2018.9064. Epub 2018 May 23.