Molecule Information
General Information of the Molecule (ID: Mol00529)
| Name |
Nuclear transcription factor Y subunit beta (NFYB)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
CAAT box DNA-binding protein subunit B; Nuclear transcription factor Y subunit B; NF-YB; HAP3
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
NFYB
|
||||
| Gene ID | |||||
| Location |
chr12:104117086-104138241[-]
|
||||
| Sequence |
MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLP
IANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILF AMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLIT TDGQQQNVMVYTTSYQQISGVQQIQFS Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on its interacting cofactors.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Lymphocytic leukemia [ICD-11: 2B33.2] | [1] | |||
| Sensitive Disease | Lymphocytic leukemia [ICD-11: 2B33.2] | |||
| Sensitive Drug | Doxorubicin | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | CEM cells | Pleural effusion | Homo sapiens (Human) | N.A. |
| CEM/VM-1-5 cells | Lymph | Homo sapiens (Human) | CVCL_1B35 | |
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
MTT assay | |||
| Mechanism Description | miR-485-3p expression can mediate etoposide sensitivity indirectly by fine-tuning Top2alpha expression through the modification of NF-YB expression. Accordingly, miR-485-3p can be a putative therapeutic target to modulate etoposide resistance in tumor cells. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Lymphocytic leukemia [ICD-11: 2B33.2] | [1] | |||
| Sensitive Disease | Lymphocytic leukemia [ICD-11: 2B33.2] | |||
| Sensitive Drug | Etoposide | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | CEM cells | Pleural effusion | Homo sapiens (Human) | N.A. |
| CEM/VM-1-5 cells | Lymph | Homo sapiens (Human) | CVCL_1B35 | |
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
MTT assay | |||
| Mechanism Description | miR-485-3p expression can mediate etoposide sensitivity indirectly by fine-tuning Top2alpha expression through the modification of NF-YB expression. Accordingly, miR-485-3p can be a putative therapeutic target to modulate etoposide resistance in tumor cells. | |||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
