Molecule Information
General Information of the Molecule (ID: Mol00529)
Name |
Nuclear transcription factor Y subunit beta (NFYB)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
CAAT box DNA-binding protein subunit B; Nuclear transcription factor Y subunit B; NF-YB; HAP3
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
NFYB
|
||||
Gene ID | |||||
Location |
chr12:104117086-104138241[-]
|
||||
Sequence |
MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLP
IANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILF AMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLIT TDGQQQNVMVYTTSYQQISGVQQIQFS Click to Show/Hide
|
||||
Function |
Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on its interacting cofactors.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Lymphocytic leukemia | [1] | |||
Sensitive Disease | Lymphocytic leukemia [ICD-11: 2B33.2] | |||
Sensitive Drug | Doxorubicin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
In Vitro Model | CEM cells | Pleural effusion | Homo sapiens (Human) | N.A. |
CEM/VM-1-5 cells | Lymph | Homo sapiens (Human) | CVCL_1B35 | |
Experiment for Molecule Alteration |
Western blotting analysis | |||
Experiment for Drug Resistance |
MTT assay | |||
Mechanism Description | miR-485-3p expression can mediate etoposide sensitivity indirectly by fine-tuning Top2alpha expression through the modification of NF-YB expression. Accordingly, miR-485-3p can be a putative therapeutic target to modulate etoposide resistance in tumor cells. |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Lymphocytic leukemia | [1] | |||
Sensitive Disease | Lymphocytic leukemia [ICD-11: 2B33.2] | |||
Sensitive Drug | Etoposide | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
In Vitro Model | CEM cells | Pleural effusion | Homo sapiens (Human) | N.A. |
CEM/VM-1-5 cells | Lymph | Homo sapiens (Human) | CVCL_1B35 | |
Experiment for Molecule Alteration |
Western blotting analysis | |||
Experiment for Drug Resistance |
MTT assay | |||
Mechanism Description | miR-485-3p expression can mediate etoposide sensitivity indirectly by fine-tuning Top2alpha expression through the modification of NF-YB expression. Accordingly, miR-485-3p can be a putative therapeutic target to modulate etoposide resistance in tumor cells. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.