Molecule Information
General Information of the Molecule (ID: Mol00489)
| Name |
Melanoma-associated antigen 2 (MAGEA2)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Cancer/testis antigen 1.2; CT1.2; MAGE-2 antigen; MAGE2; MAGEA2A; MAGE2; MAGEA2
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
MAGEA2
|
||||
| Gene ID | |||||
| Location |
chrX:152714586-152718607[+]
|
||||
| Sequence |
MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQQTASSSSTLVEVTLGEVPAADSPS
PPHSPQGASSFSTTINYTLWRQSDEGSSNQEEEGPRMFPDLESEFQAAISRKMVELVHFL LLKYRAREPVTKAEMLESVLRNCQDFFPVIFSKASEYLQLVFGIEVVEVVPISHLYILVT CLGLSYDGLLGDNQVMPKTGLLIIVLAIIAIEGDCAPEEKIWEELSMLEVFEGREDSVFA HPRKLLMQDLVQENYLEYRQVPGSDPACYEFLWGPRALIETSYVKVLHHTLKIGGEPHIS YPPLHERALREGEE Click to Show/Hide
|
||||
| Function |
Reduces p53/TP53 transactivation function through recruitment of HDAC3 to p53/TP53 transcription sites. Also represses p73/TP73 activity. Proposed to enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. In vitro enhances ubiquitin ligase activity of TRIM28 and stimulates p53/TP53 ubiquitination by TRIM28 potentially in presence of Ubl-conjugating enzyme UBE2H. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex. May play a role in embryonal development and tumor transformation or aspects of tumor progression. In vitro promotes cell viability in melanoma cell lines. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes. Negatively regulates acetylation and sumoylation of PML and represses PML-induced p53/TP53 acetylation and activation.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Medulloblastoma | [1] | |||
| Sensitive Disease | Medulloblastoma [ICD-11: 2A00.10] | |||
| Sensitive Drug | Cisplatin | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
| p53 signaling pathway | Activation | hsa04115 | ||
| In Vitro Model | UW228 cells | Brain | Homo sapiens (Human) | CVCL_8585 |
| R262 cells | Bone marrow | Homo sapiens (Human) | CVCL_VU83 | |
| R300 cells | Bone marrow | Homo sapiens (Human) | CVCL_VU84 | |
| UW426 cells | Bone marrow | Homo sapiens (Human) | CVCL_DH82 | |
| Experiment for Molecule Alteration |
Western blotting analysis | |||
| Experiment for Drug Resistance |
MTS assay | |||
| Mechanism Description | The repression of MAGE-A by miR-34a results in increased expression of p53 thus lead to resistance. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Medulloblastoma | [1] | |||
| Sensitive Disease | Medulloblastoma [ICD-11: 2A00.10] | |||
| Sensitive Drug | Mitomycin | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
| p53 signaling pathway | Activation | hsa04115 | ||
| In Vitro Model | UW228 cells | Brain | Homo sapiens (Human) | CVCL_8585 |
| R262 cells | Bone marrow | Homo sapiens (Human) | CVCL_VU83 | |
| R300 cells | Bone marrow | Homo sapiens (Human) | CVCL_VU84 | |
| UW426 cells | Bone marrow | Homo sapiens (Human) | CVCL_DH82 | |
| Experiment for Molecule Alteration |
Western blotting analysis | |||
| Experiment for Drug Resistance |
MTS assay | |||
| Mechanism Description | The repression of MAGE-A by miR-34a results in increased expression of p53 thus lead to resistance. | |||
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.
