General Information of the Molecule (ID: Mol00489)
Name
Melanoma-associated antigen 2 (MAGEA2) ,Homo sapiens
Synonyms
Cancer/testis antigen 1.2; CT1.2; MAGE-2 antigen; MAGE2; MAGEA2A; MAGE2; MAGEA2
    Click to Show/Hide
Molecule Type
Protein
Gene Name
MAGEA2
Gene ID
266740
Location
chrX:152714586-152718607[+]
Sequence
MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQQTASSSSTLVEVTLGEVPAADSPS
PPHSPQGASSFSTTINYTLWRQSDEGSSNQEEEGPRMFPDLESEFQAAISRKMVELVHFL
LLKYRAREPVTKAEMLESVLRNCQDFFPVIFSKASEYLQLVFGIEVVEVVPISHLYILVT
CLGLSYDGLLGDNQVMPKTGLLIIVLAIIAIEGDCAPEEKIWEELSMLEVFEGREDSVFA
HPRKLLMQDLVQENYLEYRQVPGSDPACYEFLWGPRALIETSYVKVLHHTLKIGGEPHIS
YPPLHERALREGEE
    Click to Show/Hide
Function
Reduces p53/TP53 transactivation function through recruitment of HDAC3 to p53/TP53 transcription sites. Also represses p73/TP73 activity. Proposed to enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. In vitro enhances ubiquitin ligase activity of TRIM28 and stimulates p53/TP53 ubiquitination by TRIM28 potentially in presence of Ubl-conjugating enzyme UBE2H. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex. May play a role in embryonal development and tumor transformation or aspects of tumor progression. In vitro promotes cell viability in melanoma cell lines. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes. Negatively regulates acetylation and sumoylation of PML and represses PML-induced p53/TP53 acetylation and activation.
    Click to Show/Hide
Uniprot ID
MAGA2_HUMAN
Ensembl ID
ENSG00000183305
HGNC ID
HGNC:19340
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Cisplatin
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Medulloblastoma [ICD-11: 2A00.10] [1]
Sensitive Disease Medulloblastoma [ICD-11: 2A00.10]
Sensitive Drug Cisplatin
Molecule Alteration Expression
Down-regulation
Experimental Note Identified from the Human Clinical Data
Cell Pathway Regulation Cell apoptosis Activation hsa04210
p53 signaling pathway Activation hsa04115
In Vitro Model UW228 cells Brain Homo sapiens (Human) CVCL_8585
R262 cells Bone marrow Homo sapiens (Human) CVCL_VU83
R300 cells Bone marrow Homo sapiens (Human) CVCL_VU84
UW426 cells Bone marrow Homo sapiens (Human) CVCL_DH82
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTS assay
Mechanism Description The repression of MAGE-A by miR-34a results in increased expression of p53 thus lead to resistance.
Mitomycin
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Medulloblastoma [ICD-11: 2A00.10] [1]
Sensitive Disease Medulloblastoma [ICD-11: 2A00.10]
Sensitive Drug Mitomycin
Molecule Alteration Expression
Down-regulation
Experimental Note Identified from the Human Clinical Data
Cell Pathway Regulation Cell apoptosis Activation hsa04210
p53 signaling pathway Activation hsa04115
In Vitro Model UW228 cells Brain Homo sapiens (Human) CVCL_8585
R262 cells Bone marrow Homo sapiens (Human) CVCL_VU83
R300 cells Bone marrow Homo sapiens (Human) CVCL_VU84
UW426 cells Bone marrow Homo sapiens (Human) CVCL_DH82
Experiment for
Molecule Alteration
Western blot analysis
Experiment for
Drug Resistance
MTS assay
Mechanism Description The repression of MAGE-A by miR-34a results in increased expression of p53 thus lead to resistance.
References
Ref 1 miR-34a confers chemosensitivity through modulation of MAGE-A and p53 in medulloblastoma. Neuro Oncol. 2011 Feb;13(2):165-75. doi: 10.1093/neuonc/noq179. Epub 2010 Dec 22.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.