Molecule Information
General Information of the Molecule (ID: Mol00489)
Name |
Melanoma-associated antigen 2 (MAGEA2)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
Cancer/testis antigen 1.2; CT1.2; MAGE-2 antigen; MAGE2; MAGEA2A; MAGE2; MAGEA2
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
MAGEA2
|
||||
Gene ID | |||||
Location |
chrX:152714586-152718607[+]
|
||||
Sequence |
MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQQTASSSSTLVEVTLGEVPAADSPS
PPHSPQGASSFSTTINYTLWRQSDEGSSNQEEEGPRMFPDLESEFQAAISRKMVELVHFL LLKYRAREPVTKAEMLESVLRNCQDFFPVIFSKASEYLQLVFGIEVVEVVPISHLYILVT CLGLSYDGLLGDNQVMPKTGLLIIVLAIIAIEGDCAPEEKIWEELSMLEVFEGREDSVFA HPRKLLMQDLVQENYLEYRQVPGSDPACYEFLWGPRALIETSYVKVLHHTLKIGGEPHIS YPPLHERALREGEE Click to Show/Hide
|
||||
Function |
Reduces p53/TP53 transactivation function through recruitment of HDAC3 to p53/TP53 transcription sites. Also represses p73/TP73 activity. Proposed to enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. In vitro enhances ubiquitin ligase activity of TRIM28 and stimulates p53/TP53 ubiquitination by TRIM28 potentially in presence of Ubl-conjugating enzyme UBE2H. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex. May play a role in embryonal development and tumor transformation or aspects of tumor progression. In vitro promotes cell viability in melanoma cell lines. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes. Negatively regulates acetylation and sumoylation of PML and represses PML-induced p53/TP53 acetylation and activation.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Medulloblastoma | [1] | |||
Sensitive Disease | Medulloblastoma [ICD-11: 2A00.10] | |||
Sensitive Drug | Cisplatin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
p53 signaling pathway | Activation | hsa04115 | ||
In Vitro Model | UW228 cells | Brain | Homo sapiens (Human) | CVCL_8585 |
R262 cells | Bone marrow | Homo sapiens (Human) | CVCL_VU83 | |
R300 cells | Bone marrow | Homo sapiens (Human) | CVCL_VU84 | |
UW426 cells | Bone marrow | Homo sapiens (Human) | CVCL_DH82 | |
Experiment for Molecule Alteration |
Western blotting analysis | |||
Experiment for Drug Resistance |
MTS assay | |||
Mechanism Description | The repression of MAGE-A by miR-34a results in increased expression of p53 thus lead to resistance. |
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Medulloblastoma | [1] | |||
Sensitive Disease | Medulloblastoma [ICD-11: 2A00.10] | |||
Sensitive Drug | Mitomycin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
p53 signaling pathway | Activation | hsa04115 | ||
In Vitro Model | UW228 cells | Brain | Homo sapiens (Human) | CVCL_8585 |
R262 cells | Bone marrow | Homo sapiens (Human) | CVCL_VU83 | |
R300 cells | Bone marrow | Homo sapiens (Human) | CVCL_VU84 | |
UW426 cells | Bone marrow | Homo sapiens (Human) | CVCL_DH82 | |
Experiment for Molecule Alteration |
Western blotting analysis | |||
Experiment for Drug Resistance |
MTS assay | |||
Mechanism Description | The repression of MAGE-A by miR-34a results in increased expression of p53 thus lead to resistance. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.