Molecule Information

General Information of the Molecule (ID: Mol00471)

• Name: Lactate dehydrogenase A (LDHA) ,Homo sapiens
• Synonyms: LDH-A; Cell proliferation-inducing gene 19 protein; LDH muscle subunit; LDH-M; Renal carcinoma antigen NY-REN-59; PIG19
• Molecule Type: Protein
• Gene Name: LDHA
• Gene ID: 3939
• Location: chr11:18394560-18408425[+]
• Sequence:
  MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKG
  EMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFI
  IPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGV
  HPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYE
  VIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGI
  SDLVKVTLTSEEEARLKKSADTLWGIQKELQF
• 3D-structure: PDB ID: 9BK2; Classification: Oxidoreductase/inhibitor; Method: X-ray diffraction; Resolution: 1.85 Å
• Uniprot ID: LDHA_HUMAN
• Ensembl ID: ENSG00000134333
• HGNC ID: HGNC:6535

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Fluorouracil

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Colon cancer [ICD-11: 2B90.1] [1]

• Sensitive Disease: Colon cancer [ICD-11: 2B90.1]
• Sensitive Drug: Fluorouracil
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• Cell Pathway Regulation: Cell apoptosis; Activation; hsa04210
• Cell Pathway Regulation: Cell proliferation; Inhibition; hsa05200
• In Vitro Model: DLD1 cells; Colon; Homo sapiens (Human); CVCL_0248
• Experiment for Molecule Alteration: Western blot analysis
• Experiment for Drug Resistance: MTT assay
• Mechanism Description: LDHA was shown to be a direct target of miR 34a. Overexpression of miR 34a reduced the expression of LDHA, probably through binding to the 3' untranslated region, leading to the re sensitization of 5 FU resistant cancer cells to 5 FU. Additionally, overexpression of LDHA rendered colon cancer cells resistant to 5 FU, suggesting that the miR 34a induced sensitization to 5 FU is mediated through the inhibition of LDHA. The current study showed that miR 34a is involved in sensitivity to 5 FU in part through its effects on LDHA expression.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Colon cancer [ICD-11: 2B90]

Differential expression of molecule in resistant diseases

• The Studied Tissue: Colon
• The Specified Disease: Colon cancer
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 1.21E-52; Fold-change: 4.43E-01; Z-score: 1.90E+00
• The Expression Level of Disease Section Compare with the Adjacent Tissue: p-value: 1.78E-13; Fold-change: 2.91E-01; Z-score: 9.38E-01

References

• Ref 1: Inhibition of lactate dehydrogenase A by microRNA-34a resensitizes colon cancer cells to 5-fluorouracil. Mol Med Rep. 2015 Jan;11(1):577-82. doi: 10.3892/mmr.2014.2726. Epub 2014 Oct 21.