Molecule Information
General Information of the Molecule (ID: Mol00360)
| Name |
Protein C-ets-1 (ETS1)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
p54; EWSR2
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
ETS1
|
||||
| Gene ID | |||||
| Location |
chr11:128458761-128587558[-]
|
||||
| Sequence |
MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQ
QRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDF VGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSF ITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGR TSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKP KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDG WEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQS LLGYTPEELHAMLDVKPDADE Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Transcription factor. Directly controls the expression of cytokine and chemokine genes in a wide variety of different cellular contexts. May control the differentiation, survival and proliferation of lymphoid cells. May also regulate angiogenesis through regulation of expression of genes controlling endothelial cell migration and invasion.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Urothelial carcinoma [ICD-11: 2C92.0] | [1] | |||
| Sensitive Disease | Urothelial carcinoma [ICD-11: 2C92.0] | |||
| Sensitive Drug | Cisplatin | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Differential expression of the molecule in resistant disease | ||||
| Classification of Disease | Ureteral cancer [ICD-11: 2C92] | |||
| The Specified Disease | Ureter cancer | |||
| The Studied Tissue | Urothelium | |||
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.91E-01 Fold-change: -4.53E-04 Z-score: -1.11E-02 |
|||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| In Vitro Model | NTUB1 cells | Bladder | Homo sapiens (Human) | CVCL_RW29 |
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
MTT assay; Flow cytometer | |||
| Mechanism Description | miR193b Mediates CEBPD-Induced Cisplatin Sensitization Through Targeting ETS1 and Cyclin D1 in Human Urothelial Carcinoma Cells. miR193b-3p, a known tumor suppressor, down-regulated proto-oncogenes Cyclin D1, and ETS1 expression and led to cell cycle arrest, cell invasion, and migration inhibition. | |||
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Colorectal cancer [ICD-11: 2B91.1] | [2] | |||
| Resistant Disease | Colorectal cancer [ICD-11: 2B91.1] | |||
| Resistant Drug | Fentanyl | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
| Cell invasion | Activation | hsa05200 | ||
| Cell migration | Activation | hsa04670 | ||
| Cell proliferation | Activation | hsa05200 | ||
| In Vitro Model | SW480 cells | Colon | Homo sapiens (Human) | CVCL_0546 |
| LOVO cells | Colon | Homo sapiens (Human) | CVCL_0399 | |
| Experiment for Molecule Alteration |
qPCR | |||
| Experiment for Drug Resistance |
Transwell assay | |||
| Mechanism Description | Fentanyl inhibits the invasion and migration of colorectal cancer cells via inhibiting the negative regulation of Ets-1 on BANCR. | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Urothelium | |
| The Specified Disease | Ureteral cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.91E-01; Fold-change: -1.17E-02; Z-score: -3.94E-02 | |
|
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
|
||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
