Molecule Information
General Information of the Molecule (ID: Mol00345)
Name |
ETS homologous factor (EHF)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
hEHF; ETS domain-containing transcription factor; Epithelium-specific Ets transcription factor 3; ESE-3; ESE3; ESE3B; ESEJ
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
EHF
|
||||
Gene ID | |||||
Location |
chr11:34621093-34663288[+]
|
||||
Sequence |
MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQ
HLLDTNQLDANCIPFQEFDINGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNGQCSSD LFQSTHNVIVKTEQTEPSIMNTWKDENYLYDTNYGSTVDLLDSKTFCRAQISMTTTSHLP VAESPDMKKEQDPPAKCHTKKHNPRGTHLWEFIRDILLNPDKNPGLIKWEDRSEGVFRFL KSEAVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNARGWRENEN Click to Show/Hide
|
||||
Function |
Transcriptional activator that may play a role in regulating epithelial cell differentiation and proliferation. May act as a repressor for a specific subset of ETS/AP-1-responsive genes and as a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades. Binds to DNA sequences containing the consensus nucleotide core sequence GGAA. Involved in regulation of TNFRSF10B/DR5 expression through Ets-binding sequences on the TNFRSF10B/DR5 promoter. May contribute to development and carcinogenesis by acting as a tumor suppressor gene or anti-oncogene.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Oral squamous cell carcinoma | [1] | |||
Sensitive Disease | Oral squamous cell carcinoma [ICD-11: 2B6E.0] | |||
Sensitive Drug | Fluorouracil | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Beta5-integrin/c-Met signaling pathway | Inhibition | hsa01521 | |
Cell apoptosis | Activation | hsa04210 | ||
Cell invasion | Inhibition | hsa05200 | ||
Cell migration | Inhibition | hsa04670 | ||
Cell viability | Inhibition | hsa05200 | ||
In Vitro Model | C9-IV3 cells | Oral | Homo sapiens (Human) | N.A. |
CGHNC9 cells | Oral | Homo sapiens (Human) | N.A. | |
OC-3 cells | Oral | Homo sapiens (Human) | CVCL_WL09 | |
In Vivo Model | CB17-SCID mice xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
MTT assay; Flow cytometry assay | |||
Mechanism Description | miR-365-3p targets EHF to inhibit OSCC migration, invasion, and metastasis through kRT16. |
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Oral tissue | |
The Specified Disease | Oral squamous cell carcinoma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.86E-05; Fold-change: -1.23E+00; Z-score: -1.24E+00 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 7.44E-21; Fold-change: -2.27E+00; Z-score: -1.79E+00 | |
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances |
![]() |
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
![]() |
||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.