Molecule Information
General Information of the Molecule (ID: Mol00327)
| Name |
Dickkopf-related protein 2 (DKK2)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
Dickkopf-2; Dkk-2; hDkk-2; UNQ682/PRO1316
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
DKK2
|
||||
| Gene ID | |||||
| Location |
chr4:106921802-107283806[-]
|
||||
| Sequence |
MAALMRSKDSSCCLLLLAAVLMVESSQIGSSRAKLNSIKSSLGGETPGQAANRSAGMYQG
LAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPST RCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEG DPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCK VWKDATYSSKARLHVCQKI Click to Show/Hide
|
||||
| Function |
Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease (By similarity).
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
| Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Esophageal adenocarcinoma [ICD-11: 2B70.2] | [1] | |||
| Resistant Disease | Esophageal adenocarcinoma [ICD-11: 2B70.2] | |||
| Resistant Drug | Fluorouracil | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Experimental Note | Identified from the Human Clinical Data | |||
| Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
| Cell colony | Activation | hsa05200 | ||
| Cell proliferation | Activation | hsa05200 | ||
| Wnt/Beta-catenin/EMT signaling pathway | Activation | hsa04310 | ||
| In Vitro Model | OE19 cells | Esophagus | Homo sapiens (Human) | CVCL_1622 |
| OE33 cellss | Esophagus | Homo sapiens (Human) | CVCL_0471 | |
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
Annexin V-fluorescein isothiocyanate (FITC) and propidium iodide (PI) staining assay | |||
| Mechanism Description | miR-221 mediates chemoresistance of esophageal adenocarcinoma by direct targeting and reducing of Dkk2 expression. | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Esophagus | |
| The Specified Disease | Esophageal cancer | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 4.12E-02; Fold-change: 6.43E-02; Z-score: 7.57E-01 | |
|
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
|
||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
