Molecule Information
General Information of the Molecule (ID: Mol00309)
| Name |
C-terminal-binding protein 1 (CTBP1)
,Homo sapiens
|
||||
|---|---|---|---|---|---|
| Synonyms |
CtBP1; CTBP
Click to Show/Hide
|
||||
| Molecule Type |
Protein
|
||||
| Gene Name |
CTBP1
|
||||
| Gene ID | |||||
| Location |
chr4:1211445-1249953[-]
|
||||
| Sequence |
MGSSHLLNKGLPLGVRPPIMNGPLHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQ
EIHEKVLNEAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNV PAASVEETADSTLCHILNLYRRATWLHQALREGTRVQSVEQIREVASGAARIRGETLGII GLGRVGQAVALRAKAFGFNVLFYDPYLSDGVERALGLQRVSTLQDLLFHSDCVTLHCGLN EHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFS QGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHLTAAT HWASMDPAVVHPELNGAAYRYPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHA PSPGQTVKPEADRDHASDQL Click to Show/Hide
|
||||
| 3D-structure |
|
||||
| Function |
Corepressor targeting diverse transcription regulators such as GLIS2 or BCL6. Has dehydrogenase activity. Involved in controlling the equilibrium between tubular and stacked structures in the Golgi complex. Functions in brown adipose tissue (BAT) differentiation.
Click to Show/Hide
|
||||
| Uniprot ID | |||||
| Ensembl ID | |||||
| HGNC ID | |||||
| Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Breast cancer [ICD-11: 2C60.3] | [1] | |||
| Sensitive Disease | Breast cancer [ICD-11: 2C60.3] | |||
| Sensitive Drug | Cisplatin | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
| Cell invasion | Inhibition | hsa05200 | ||
| Cell migration | Inhibition | hsa04670 | ||
| Cell proliferation | Inhibition | hsa05200 | ||
| miR644a/CTBP1/p53 signaling pathway | Activation | hsa05206 | ||
| In Vitro Model | MCF-7 cells | Breast | Homo sapiens (Human) | CVCL_0031 |
| SkBR3 cells | Breast | Homo sapiens (Human) | CVCL_0033 | |
| MDA-MB-231 cells | Breast | Homo sapiens (Human) | CVCL_0062 | |
| BT474 cells | Breast | Homo sapiens (Human) | CVCL_0179 | |
| ZR75-1 cells | Breast | Homo sapiens (Human) | CVCL_0588 | |
| MCF10A cells | Breast | Homo sapiens (Human) | CVCL_0598 | |
| MCF-12A cells | Breast | Homo sapiens (Human) | CVCL_3744 | |
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
RTCA proliferation and migration assay; Promega assay | |||
| Mechanism Description | miR-644a directly targets transcriptional co-repressor CTBP1 and thereby upregulates p53 levels and the miR-644a/CTBP1/p53 axis suppresses drug resistance by simultaneous inhibition of cell survival and epithelial-mesenchymal transition in breast cancer. | |||
| Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
|
|
||||
| Disease Class: Breast cancer [ICD-11: 2C60.3] | [1] | |||
| Sensitive Disease | Breast cancer [ICD-11: 2C60.3] | |||
| Sensitive Drug | Doxorubicin | |||
| Molecule Alteration | Expression | Down-regulation |
||
| Experimental Note | Revealed Based on the Cell Line Data | |||
| Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
| Cell invasion | Inhibition | hsa05200 | ||
| Cell migration | Inhibition | hsa04670 | ||
| Cell proliferation | Inhibition | hsa05200 | ||
| miR644a/CTBP1/p53 signaling pathway | Activation | hsa05206 | ||
| In Vitro Model | MCF-7 cells | Breast | Homo sapiens (Human) | CVCL_0031 |
| SkBR3 cells | Breast | Homo sapiens (Human) | CVCL_0033 | |
| MDA-MB-231 cells | Breast | Homo sapiens (Human) | CVCL_0062 | |
| BT474 cells | Breast | Homo sapiens (Human) | CVCL_0179 | |
| ZR75-1 cells | Breast | Homo sapiens (Human) | CVCL_0588 | |
| MCF10A cells | Breast | Homo sapiens (Human) | CVCL_0598 | |
| MCF-12A cells | Breast | Homo sapiens (Human) | CVCL_3744 | |
| Experiment for Molecule Alteration |
Western blot analysis | |||
| Experiment for Drug Resistance |
RTCA proliferation and migration assay; Promega assay | |||
| Mechanism Description | miR-644a directly targets transcriptional co-repressor CTBP1 and thereby upregulates p53 levels and the miR-644a/CTBP1/p53 axis suppresses drug resistance by simultaneous inhibition of cell survival and epithelial-mesenchymal transition in breast cancer. | |||
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
| Differential expression of molecule in resistant diseases | ||
| The Studied Tissue | Breast tissue | |
| The Specified Disease | Breast cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.27E-16; Fold-change: 2.88E-01; Z-score: 5.27E-01 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.71E-03; Fold-change: 1.28E-01; Z-score: 2.09E-01 | |
|
Molecule expression in the normal tissue adjacent to the diseased tissue of patients
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
| Disease-specific Molecule Abundances |
|
Click to View the Clearer Original Diagram |
Tissue-specific Molecule Abundances in Healthy Individuals
|
||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.
