Molecule Information

General Information of the Molecule (ID: Mol00295)

• Name: Claudin-2 (CLDN2) ,Homo sapiens
• Synonyms: SP82; PSEC0059; SP82; UNQ705/PRO1356
• Molecule Type: Protein
• Gene Name: CLDN2
• Gene ID: 9075
• Location: chrX:106900164-106930861[+]
• Sequence:
  MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTG
  ITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVA
  GGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGII
  LCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV
• Function: Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
• Uniprot ID: CLD2_HUMAN
• Ensembl ID: ENSG00000165376
• HGNC ID: HGNC:2041

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Doxorubicin

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Lung adenocarcinoma [1]

• Sensitive Disease: Lung adenocarcinoma [ICD-11: 2C25.0]
• Sensitive Drug: Doxorubicin
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• Cell Pathway Regulation: Nrf2 signaling pathway; Inhibition; hsa05208
• In Vitro Model: A549 cells; Lung; Homo sapiens (Human); CVCL_0023
• Experiment for Molecule Alteration: Western blotting analysis
• Mechanism Description: CLDN2 knockdown attenuated the expression of Nrf2 and the Nrf2-targeted genes. The DXR-induced toxicity was enhanced by CLDN2 knockdown, which was inhibited by an Nrf2 activator sulforaphane.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Lung cancer [ICD-11: 2C25]

Differential expression of molecule in resistant diseases

• The Studied Tissue: Lung
• The Specified Disease: Lung cancer
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 1.91E-09; Fold-change: -4.85E-02; Z-score: -7.55E-02
• The Expression Level of Disease Section Compare with the Adjacent Tissue: p-value: 6.13E-23; Fold-change: 1.17E-01; Z-score: 2.70E-01

References

• Ref 1: Elevation of Chemosensitivity of Lung Adenocarcinoma A549 Spheroid Cells by Claudin-2 Knockdown through Activation of Glucose Transport and Inhibition of Nrf2 Signal. Int J Mol Sci. 2021 Jun 19;22(12):6582. doi: 10.3390/ijms22126582.