General Information of the Molecule (ID: Mol00274)
Name
Monocyte chemotactic and activating factor (CCL2) ,Homo sapiens
Synonyms
HC11; Monocyte chemoattractant protein 1; Monocyte chemotactic and activating factor; MCAF; Monocyte chemotactic protein 1; MCP-1; Monocyte secretory protein JE; Small-inducible cytokine A2; MCP1; SCYA2
    Click to Show/Hide
Molecule Type
Protein
Gene Name
CCL2
Gene ID
6347
Location
chr17:34255274-34257208[+]
Sequence
MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP
KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT
    Click to Show/Hide
3D-structure
PDB ID
4ZK9
Classification
Viral protein/cytokine
Method
X-ray diffraction
Resolution
2.60  Å
Function
Acts as a ligand for C-C chemokine receptor CCR2. Signals through binding and activation of CCR2 and induces a strong chemotactic response and mobilization of intracellular calcium ions. Exhibits a chemotactic activity for monocytes and basophils but not neutrophils or eosinophils. May be involved in the recruitment of monocytes into the arterial wall during the disease process of atherosclerosis.
    Click to Show/Hide
Uniprot ID
CCL2_HUMAN
Ensembl ID
ENSG00000108691
HGNC ID
HGNC:10618
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Type(s) of Resistant Mechanism of This Molecule
  EADR: Epigenetic Alteration of DNA, RNA or Protein
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Click to Show/Hide the Full List of Drugs
Melatonin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
  Epigenetic Alteration of DNA, RNA or Protein (EADR) Click to Show/Hide
Disease Class: Autoimmune disease [ICD-11: 4A4Z.0] [1]
Resistant Disease Autoimmune disease [ICD-11: 4A4Z.0]
Resistant Drug Melatonin
Molecule Alteration Down-regulation
Expression
Experimental Note Identified from the Human Clinical Data
Experiment for
Molecule Alteration
Knockdown assay
Mechanism Description The conclusion on a partial mediation by SIRT1 is supported by repeatedly observed inhibitions of melatonin effects by sirtuin inhibitors or knockdown.
Vemurafenib
Click to Show/Hide
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
  Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Melanoma [ICD-11: 2C30.0] [2]
Sensitive Disease Melanoma [ICD-11: 2C30.0]
Sensitive Drug Vemurafenib
Molecule Alteration Expression
Down-regulation
Experimental Note Revealed Based on the Cell Line Data
Cell Pathway Regulation Cell apoptosis Activation hsa04210
Cell invasion Inhibition hsa05200
Cell migration Inhibition hsa04670
Cell proliferation Inhibition hsa05200
In Vitro Model PLX4032-resistant cells Skin Homo sapiens (Human) N.A.
Experiment for
Molecule Alteration
qRT-PCR
Experiment for
Drug Resistance
MTT assay
Mechanism Description CCL2 and miR-125b, miR-34a and miR-100 are potential targets for overcoming the miR-34a and miR-100 are potential targets for overcoming the resistance to BRAFi in melanoma.
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Click to Show/Hide the Resistance Disease of This Class
Melanoma [ICD-11: 2C30]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Skin
The Specified Disease Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.07E-02; Fold-change: 8.17E-02; Z-score: 5.15E-02
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 04
Click to Show/Hide the Resistance Disease of This Class
Autoimmune disease [ICD-11: 4A4Z]
Click to Show/Hide
Differential expression of molecule in resistant diseases
The Studied Tissue Peripheral monocyte
The Specified Disease Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.58E-01; Fold-change: 6.70E-01; Z-score: 9.01E-01
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances Click to View the Clearer Original Diagram
Tissue-specific Molecule Abundances in Healthy Individuals
Click to Show/Hide the Molecule Abundances
References
Ref 1 Melatonin and inflammation-Story of a double-edged bladeJ Pineal Res. 2018 Nov;65(4):e12525. doi: 10.1111/jpi.12525. Epub 2018 Oct 12.
Ref 2 Overcoming melanoma resistance to vemurafenib by targeting CCL2-induced miR-34a, miR-100 and miR-125b. Oncotarget. 2016 Jan 26;7(4):4428-41. doi: 10.18632/oncotarget.6599.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Yu.