Molecule Information
General Information of the Molecule (ID: Mol00231)
Name |
Beta adrenoceptor kinase 1 (GRK2)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
Beta-ARK-1; G-protein coupled receptor kinase 2; ADRBK1; BARK; BARK1
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
GRK2
|
||||
Gene ID | |||||
Location |
chr11:67266473-67286556[+]
|
||||
Sequence |
MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFS
QKLGYLLFRDFCLNHLEEARPLVEFYEEIKKYEKLETEEERVARSREIFDSYIMKELLAC SHPFSKSATEHVQGHLGKKQVPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNV ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER IMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAE IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE VLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE LRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAA DAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARK KAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSL LTMEEIQSVEETQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQR VPKMKNKPRSPVVELSKVPLVQRGSANGL Click to Show/Hide
|
||||
Function |
Specifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors, probably inducing a desensitization of them. Key regulator of LPAR1 signaling. Competes with RALA for binding to LPAR1 thus affecting the signaling properties of the receptor. Desensitizes LPAR1 and LPAR2 in a phosphorylation-independent manner. Positively regulates ciliary smoothened (SMO)-dependent Hedgehog (Hh) signaling pathway by facilitating the trafficking of SMO into the cilium and the stimulation of SMO activity. Inhibits relaxation of airway smooth muscle in response to blue light.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
|
||||
Disease Class: Leukemia | [1] | |||
Resistant Disease | Leukemia [ICD-11: 2B33.6] | |||
Resistant Drug | Daunorubicin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
In Vitro Model | THP-1 cells | Blood | Homo sapiens (Human) | CVCL_0006 |
HEK293T cells | Kidney | Homo sapiens (Human) | CVCL_0063 | |
HL60 cells | Peripheral blood | Homo sapiens (Human) | CVCL_0002 | |
K562 cells | Blood | Homo sapiens (Human) | CVCL_0004 | |
Experiment for Molecule Alteration |
Luciferase reporter assay; Western blot analysis | |||
Experiment for Drug Resistance |
Luminescent cell viability assay | |||
Mechanism Description | miR125a mediated daunorubicin resistance in leukemia cell lines through the decrease of GRk2 and Puma which were proved to be direct targets of miR125a. Overexpression of miR125a induced drug resistance in HL-60, k562, and THP-1cell lines through reducing apoptosis. | |||
Disease Class: Leukemia | [2] | |||
Resistant Disease | Leukemia [ICD-11: 2B33.6] | |||
Resistant Drug | Daunorubicin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | THP-1 cells | Blood | Homo sapiens (Human) | CVCL_0006 |
Jurkat cells | Pleural effusion | Homo sapiens (Human) | CVCL_0065 | |
K562 cells | Blood | Homo sapiens (Human) | CVCL_0004 | |
REH cells | Bone marrow | Homo sapiens (Human) | CVCL_1650 | |
Experiment for Molecule Alteration |
Western blotting analysis | |||
Experiment for Drug Resistance |
Luminescent cell viability assay | |||
Mechanism Description | miR-125b downregulated GRk2 and PUMA, which inhibited apoptosis and induced leukemia cell resistance to DNR. |
References
visits since 2022
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.